KEGG   Gordonia bronchialis: Gbro_4532Help
Entry
Gbro_4532         CDS       T01102                                 

Definition
DNA polymerase LigD
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
gbr  Gordonia bronchialis
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gbr03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:gbr03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:gbr03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:gbr03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4858722..4861115
Genome map
AA seq 797 aa AA seqDB search
MAPGDGTHLDVDGHRISITNLTKVLYPQTGTRKFEVIDYYSRIADVLLPHLRGRLVTRKR
WPNGVESTPFFEKDMPESAPAWITRHGIEHSQRVINYAVVDSRATLVWLAQMAALELHAH
QWRLPVIDDALRANRMVLDLDPGPGVPLTECAAVARLIRDLLADAGMDTYPVTSGGKGIH
VYARLPRPVSPDAARTLAKEIATRLSREHPDTITATMAKTHREQRIFIDWSQNSGSKTTL
SPYSLRGREQPWVAAPRTWDELDDPGLDQLLYTDVLDRVDERGDLLDGLDDDYPASGPPS
EQTEVHTPRPPTEDSTGTDDRQVINLREYRRKRDAAKTPEPFGDESHQSRTAQTAAPSGD
PIFVIQEHHARRLHYDFRLEHDGVLVSWAVPKNLPTDPDQNRLAVRTEDHPMDYADFEGD
IPAGEYGGGHVSIWDRGTFTTEKWREKEIIVRLAGERVQGRYALIKTGDKNWLAHLMSDE
PRPIVPDSLSDPRPMLATDEDIEGLSESEWAFEGKWDGYRILLRYIGGELRLTSRSGIDM
TRDFPEIAEITEHLGLLDVVLDGEVVALDSTGRTNFTLLTSRNHTDEPYTLRLYLFDILY
LNGASLLRKTWTQRRELLEELAPAFRHSRYVEVPPLLPGPGQVAADHSREHNMEGVVAKR
RSSIYQQGRRSASWLKHKNWSDIEVVIGGWRPGRGSRENTIGSLLLGLPEETGLRYVGRV
GTGFTDAALASLAQELEPLRISRSPFLEKLDRPVASTAIWVLPKIVGEVRFMDWTTTGHL
RHPSWRGIRRDKLPGDL
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggcacccggtgacggcacacacctcgacgtcgacggccaccggatctcgatcaccaac
ctgaccaaggtgctctatccgcaaaccgggacacgcaagttcgaggtcatcgactattac
tcacgcatcgccgacgtactgcttccgcatctgcgtggccggctcgtcacgcgcaaacgc
tggcccaacggtgtcgaatccaccccgttcttcgagaaggacatgcccgagagtgcgccc
gcgtggatcacccggcacggcatcgaacacagtcagcgcgtcatcaactacgccgtggtg
gactcgcgggcgacgctggtctggctcgcccagatggccgcactggagttacatgcgcac
cagtggcggttgcccgtcatcgacgacgcgctgcgggccaatcggatggtgctcgacctc
gaccccgggccgggggtcccgctcaccgaatgcgcggcggtggcccggctcatccgcgat
ctgctcgccgacgccgggatggacacctacccggtcaccagcggcggcaagggaattcac
gtctacgctcgactcccccggccggtgtcaccggatgccgcgcgcacgctggccaaggag
atcgccacccgactcagtcgagagcatcccgacaccatcaccgcgacgatggcgaaaacc
catcgggaacaacggatcttcatcgactggagtcagaacagcggttccaagacgacgctg
tcgccgtattcattgcgcggtcgcgaacaaccctgggtcgccgcgccccgtacctgggac
gaactcgacgatcccggccttgatcagttgctctacaccgacgtcctcgaccgcgtcgac
gagcgcggcgatctgctcgacggcctcgacgacgactacccggcgtccggcccaccatcc
gagcaaaccgaagtgcacaccccaaggcccccaaccgaagacagcaccggcaccgacgat
cgacaggtcatcaacctgcgcgagtaccgccgcaaacgcgacgcggcgaagacacccgaa
ccgttcggagacgagagccatcagagccggacagcccaaaccgccgcccccagcggcgat
cccatcttcgtcatccaggagcatcacgcacgacggttgcactacgacttccgtctcgaa
cacgacggcgtcctggtgtcctgggcggtgccgaagaatctgccgaccgacccggaccag
aaccggctggccgtccggaccgaggatcatccgatggactacgccgatttcgagggcgac
atcccggccggcgagtacggcggcgggcacgtatccatctgggatcgaggcactttcacc
accgagaagtggcgggagaaggagatcatcgtccggctggccggggagcgggtgcagggg
cggtacgccctgatcaagaccggcgacaagaactggctcgcacatctgatgagtgacgaa
ccgcgccccatcgtccccgacagcctctccgacccaaggccgatgctggccaccgacgag
gacatcgagggactctccgaatccgagtgggccttcgagggcaagtgggacggataccga
atcctgttgcgttacatcggtggcgaactccgcctgacctctcgatcgggtatcgacatg
acccgcgacttccccgagatcgccgagatcaccgagcatctcggcctcctcgacgtggtc
ctcgacggcgaggtggtggccctcgattccaccggccgcaccaacttcaccctgctgacc
tcgcgcaaccacaccgatgagccatatacgttgcggctctacctgttcgacatcctttac
ctcaacggcgcgtcgctcctgcgcaagacctggacgcagcggcgcgaactcctcgaggag
ctcgcgccggccttccgccactcccgctacgtcgaggtgccacccctgctccccggtccg
ggccaggtggctgccgaccacagtcgcgaacacaacatggaaggtgttgtggccaaacgc
cgttcctccatctaccagcagggccgacggtccgcgtcgtggctcaagcacaagaactgg
agcgacatcgaagtcgtcatcggcgggtggcgacccggccgcggatcacgggagaacacc
atcgggtcgctgctcttgggcctgccggaggaaaccggcctgcgctatgtggggcgcgtc
ggaaccggattcaccgacgccgcgctggcctccctcgcccaggaactcgaacccctgcgg
atctcacggtcgccgttcctggagaagctcgaccgcccggtcgcgtcgacggcgatctgg
gtgctccccaagatcgtcggcgaggtccggttcatggactggaccaccaccggccacctc
cgacacccgagctggcgcggcatccggcgtgacaaactgcccggcgacctgtga

DBGET integrated database retrieval system