KEGG   Gordonia bronchialis: Gbro_4648Help
Entry
Gbro_4648         CDS       T01102                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gbr  Gordonia bronchialis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gbro_4648
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbro_4648
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gbro_4648
Enzymes [BR:gbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gbro_4648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4979585..4980715
Genome map
AA seq 376 aa AA seqDB search
MDGEPYLYERSGRRYPIDDWRWRGDDGSPLSVSAMTGPTPDPIDSAERSLWRYRAALPVD
AEHRISLGEGCTPMPALDWRGHRVRFKLEWFNPTGSFKDRGVSVMISHLQSQGVTRVLED
SSGNGGSAVAGYAAAAGMDAKILVPAATSPAKILQARAYGAEIELVGGTRDDVGDEAIRQ
SAFIPYASHNWHPMFIQGTKTIGYEIWEDLGFRVPDNIVLVAGAGSVALGCDLAATELLA
TGAIDRRPRLFVGQPADWATIAELVNGVTGPDDAQRRPTIAEGASIARPVRLPEVAAAIT
RSDGGAVAVSEDSIHAAVRALAGRGLYAEPTSAVAAAALDHFIDTGDIRSDQITVVVLTG
SGLKSPARMGEVVGVS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtggacggtgagccttatctgtacgagcgcagcggacgccggtacccgatcgacgactgg
cgctggcgcggcgatgacggatcgccgctgtcggtgagcgcgatgaccgggccgacgccg
gatccgatcgattcagccgagcggtcgctgtggcggtaccgcgcggctcttcccgtcgac
gccgagcaccgaatcagtctcggcgagggttgcacaccgatgccggcactcgactggcgt
gggcatcgggtgcgcttcaagctcgaatggttcaatcccaccggcagtttcaaggatcgc
ggggtgtcggtgatgatctcgcatctgcagtcccagggtgtcacccgggtgctggaggat
tcgtcgggcaatggcggcagcgccgtcgccggttatgcggccgccgccgggatggacgcg
aagatcctggtgccggcggcgacgtcacccgccaagatcctgcaggcgcgtgcctacggc
gcggagatcgagctcgtcggaggtacccgcgacgacgtcggcgacgaggccatccggcag
tccgcgttcattccgtatgcgagtcacaactggcatccgatgttcatccagggcaccaag
accatcgggtacgagatctgggaggatctcggcttccgcgtacccgacaacatcgttctg
gtcgccggggccggcagcgtcgcgctcggttgcgatctggcggcgaccgaactgctggct
accggggcgatcgatcgtcggccgcgactgttcgtcggacagccggcggattgggccacc
atcgccgagttggtcaacggcgtcaccggccccgacgatgcgcaacgtcgacccaccatc
gccgaaggcgcttcgatagcccggccggtgcgtctgccagaggtggccgcggcgatcacc
cggtccgacggtggggccgtggccgtatcggaggacagcatccacgcggcggtccgggcg
ctcgccggacgtgggctctacgccgaaccgaccagcgctgttgccgccgccgcactcgac
cacttcatcgacaccggcgacatccgatccgaccagatcaccgtcgtcgtgctcaccggg
agcggcctgaaatcgccggcgcggatgggcgaggttgtcggggtgtcctga

DBGET integrated database retrieval system