KEGG   Gordonia bronchialis: Gbro_4648Help
Entry
Gbro_4648         CDS       T01102                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gbr  Gordonia bronchialis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gbro_4648
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbro_4648
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gbro_4648
Enzymes [BR:gbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gbro_4648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4979585..4980715
Genome map
AA seq 376 aa AA seqDB search
MDGEPYLYERSGRRYPIDDWRWRGDDGSPLSVSAMTGPTPDPIDSAERSLWRYRAALPVD
AEHRISLGEGCTPMPALDWRGHRVRFKLEWFNPTGSFKDRGVSVMISHLQSQGVTRVLED
SSGNGGSAVAGYAAAAGMDAKILVPAATSPAKILQARAYGAEIELVGGTRDDVGDEAIRQ
SAFIPYASHNWHPMFIQGTKTIGYEIWEDLGFRVPDNIVLVAGAGSVALGCDLAATELLA
TGAIDRRPRLFVGQPADWATIAELVNGVTGPDDAQRRPTIAEGASIARPVRLPEVAAAIT
RSDGGAVAVSEDSIHAAVRALAGRGLYAEPTSAVAAAALDHFIDTGDIRSDQITVVVLTG
SGLKSPARMGEVVGVS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtggacggtgagccttatctgtacgagcgcagcggacgccggtacccgatcgacgactgg
cgctggcgcggcgatgacggatcgccgctgtcggtgagcgcgatgaccgggccgacgccg
gatccgatcgattcagccgagcggtcgctgtggcggtaccgcgcggctcttcccgtcgac
gccgagcaccgaatcagtctcggcgagggttgcacaccgatgccggcactcgactggcgt
gggcatcgggtgcgcttcaagctcgaatggttcaatcccaccggcagtttcaaggatcgc
ggggtgtcggtgatgatctcgcatctgcagtcccagggtgtcacccgggtgctggaggat
tcgtcgggcaatggcggcagcgccgtcgccggttatgcggccgccgccgggatggacgcg
aagatcctggtgccggcggcgacgtcacccgccaagatcctgcaggcgcgtgcctacggc
gcggagatcgagctcgtcggaggtacccgcgacgacgtcggcgacgaggccatccggcag
tccgcgttcattccgtatgcgagtcacaactggcatccgatgttcatccagggcaccaag
accatcgggtacgagatctgggaggatctcggcttccgcgtacccgacaacatcgttctg
gtcgccggggccggcagcgtcgcgctcggttgcgatctggcggcgaccgaactgctggct
accggggcgatcgatcgtcggccgcgactgttcgtcggacagccggcggattgggccacc
atcgccgagttggtcaacggcgtcaccggccccgacgatgcgcaacgtcgacccaccatc
gccgaaggcgcttcgatagcccggccggtgcgtctgccagaggtggccgcggcgatcacc
cggtccgacggtggggccgtggccgtatcggaggacagcatccacgcggcggtccgggcg
ctcgccggacgtgggctctacgccgaaccgaccagcgctgttgccgccgccgcactcgac
cacttcatcgacaccggcgacatccgatccgaccagatcaccgtcgtcgtgctcaccggg
agcggcctgaaatcgccggcgcggatgggcgaggttgtcggggtgtcctga

DBGET integrated database retrieval system