KEGG   Gallionella capsiferriformans: Galf_0061Help
Entry
Galf_0061         CDS       T01295                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
gca  Gallionella capsiferriformans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Galf_0061
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_0061
   00020 Citrate cycle (TCA cycle)
    Galf_0061
   00620 Pyruvate metabolism
    Galf_0061
   00640 Propanoate metabolism
    Galf_0061
   00650 Butanoate metabolism
    Galf_0061
  Energy metabolism
   00680 Methane metabolism
    Galf_0061
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Galf_0061
Enzymes [BR:gca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Galf_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(69456..70709)
Genome map
AA seq 417 aa AA seqDB search
MLKQTEGSKAVAEAIALCRPEVICAYPISPQTHIVEALGESVKSGELTPCEFINVESEFA
AMSVAIGASAAGARAYTATASQGLLFMAEAVYNASGLGLPIVMTVANRAIGAPINIWNDH
SDSLSQRESGWMQLFAETNQEAVDLHIQAFRLAEELSMPIMVCMDGFILTHAFERVDIPS
QAQVDAYLPPFEPRQVLDPAEPVSIGAMVGPEAFMEVRYLAHAKQMQAIERIPQLASEFR
EIFGRDSGGLIRTYCTEDADTIIIAMGSVLGTIKDTVDEMRAEGHKIGVLGIISYRPFPL
EQVKAALINCRRFVVLEKSLAVGMGGIVATDVRMAVTGTGLKGFTAIAGLGGRPITKASL
HKLFREAEAETLPPVTFLDLDWDAVNKQLAREKQTRRSGPVAENILHDKGIVSAKFG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagcagactgaaggctcaaaagcggtcgccgaagccatcgcactgtgccgccct
gaagtcatctgcgcctatccgatttccccgcagacgcacatcgtcgaggcgctgggcgag
agcgtcaaatcaggcgaactcaccccctgcgaatttatcaacgtcgagagtgaatttgcc
gccatgtcggtggcgataggtgcttccgctgccggtgcgcgcgcctacaccgcgaccgca
tcgcaaggcctgctgttcatggcagaggcggtctacaacgcatcggggctggggctgccg
attgtcatgacggtcgccaatcgtgccatcggtgcaccgatcaatatctggaacgatcac
tccgactcgctctcgcagcgtgaatcgggctggatgcagttgtttgccgagaccaatcag
gaagcggttgatctgcacatacaggcgtttcggctggccgaagaactctccatgccgatc
atggtgtgcatggacggtttcatcctgacgcacgccttcgaacgcgtcgatattccgtcg
caagcacaggtagacgcctatctgccaccgttcgagccgcgtcaggtactcgaccctgcc
gagccggtttccatcggcgcgatggtcggccccgaagcctttatggaggtgcgctatctt
gcgcacgccaaacagatgcaagccatcgagcgcattccgcaactggccagcgaatttcgc
gagattttcgggcgggacagcggcgggctaatccgcacgtattgcacggaagacgccgac
accatcattatcgccatgggctcggtgctcggcaccatcaaagacacggtggatgaaatg
cgtgcagaaggccacaaaatcggcgtgctgggcattatcagttatcgccccttcccgctg
gaacaggtcaaggcggcgctgatcaactgccgtcgctttgtcgtactcgaaaaaagtctg
gcggtcggcatgggcggcatcgtggcgaccgatgtgcgcatggcagtgaccggcaccggc
ctcaaaggttttaccgcgatcgcgggtctgggggggcgccccatcacaaaagcctcgctg
cacaaactgttcagagaggccgaagccgaaacgctgccgccggtgaccttcctcgatctg
gactgggatgcggttaacaaacagctggcgcgggagaaacaaacccgccgctccgggcct
gtcgccgaaaacatcctgcacgacaaaggcatcgtttcagcaaagttcggttaa

DBGET integrated database retrieval system