KEGG   Gallionella capsiferriformans: Galf_0062Help
Entry
Galf_0062         CDS       T01295                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
gca  Gallionella capsiferriformans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Galf_0062
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_0062
   00020 Citrate cycle (TCA cycle)
    Galf_0062
   00620 Pyruvate metabolism
    Galf_0062
   00640 Propanoate metabolism
    Galf_0062
   00650 Butanoate metabolism
    Galf_0062
  Energy metabolism
   00680 Methane metabolism
    Galf_0062
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Galf_0062
Enzymes [BR:gca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Galf_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(70693..71283)
Genome map
AA seq 196 aa AA seqDB search
MFQIRVHGRGGQGVVTAAEMLSVAAFEEGRHAQAFPSFGSERTGAPVVAFCRISDKEIRL
REPIMEPDAIIIQDPTLLHQIDVFAGLKPDGYVLLNSHHSIEALGLAELVKGRQPERFCT
LPASELGLKHVGRPIPNVPLLAGFAALSGIIRLESVILAINERFTGKIAAGNITAATEAY
ERVQQQMKEQAHAKAD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgttccagattcgtgttcacgggcgcggcggacagggggtcgtcaccgctgctgagatg
ttatccgtcgcggcattcgaagaaggacgtcatgcacaggccttccccagcttcggctca
gagcgcaccggcgcgccggtggtggccttctgccggatttcggataaagaaatccgcttg
cgtgaaccgatcatggagcccgatgcgatcatcattcaggatcccactctgctgcatcag
atcgacgtgttcgccggattaaaacccgatggctacgtgctactcaattcgcatcacagc
attgaagcgctgggactcgccgaacttgtcaaaggccgacagcctgaacgattctgcacc
ttgccggcctctgagcttggcctcaaacatgtcggacgccccatccctaacgtccccctt
ttagcgggattcgcagccctctccggcatcattcgcttggaatcggtgatcctcgcgatc
aatgaacggttcaccggcaaaatcgctgcaggtaacatcaccgccgcaacggaagcctat
gaacgggtacagcaacaaatgaaggagcaggcacatgctaaagcagactga

DBGET integrated database retrieval system