KEGG   Gallionella capsiferriformans: Galf_0137Help
Entry
Galf_0137         CDS       T01295                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gca  Gallionella capsiferriformans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Galf_0137
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Galf_0137
Enzymes [BR:gca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Galf_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
165593..166549
Genome map
AA seq 318 aa AA seqDB search
MKNPQLNKHGELQHLLTTEGLPVRIMRDILDRAATFLDIDEGREIKKVPLLHGKSVFNVF
FENSTRTRTTFEIAAKRLSADVVNLNIGSSSTSKGETLLDTVDNLCAMHADMFVVRHSQS
GAAHLIARHVAPEIHVINAGDGRHAHPTQALLDMFTIRHYKKEFHNLRVAIVGDVLHSRV
ARSQIHALTTLGVPEVRVIAPKTLLPTMVENLGVRVYHDMAQGLRDVDVVLMLRLQNERM
QGAALPSGQEYFKNYGLTEEKLAYAKPDAIVMHPGPMNRGIEIDSRVADGMQSVILSQVT
FGIAVRMAVMSTLAGSNK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatccgcaactcaataaacacggtgaactgcagcatcttctgaccacggaaggc
ttgccggtacgcatcatgcgcgacattctcgaccgtgctgccaccttcctcgatatcgac
gaggggcgcgaaatcaagaaagtgccgctcttgcacggcaagtcggtattcaatgtgttc
ttcgagaacagtacccgtacccgcaccacttttgaaatcgccgccaagcgcctgtctgct
gacgtggtcaatctgaacatcggatcgtcctccaccagcaagggtgaaacgctgctcgat
acggtcgacaatctgtgcgcgatgcatgccgacatgttcgtagtgcgccattcgcaaagc
ggtgcggcgcatctgatcgcgcggcatgtcgcgccggaaattcacgtcatcaatgccggt
gacgggcgtcatgcgcatccgacgcaagccttgctcgacatgttcaccatccgtcattac
aagaaggaatttcacaatcttcgcgtagcgatcgtaggcgatgtgttgcattcgcgtgtg
gcgcgctcgcaaattcatgcgctgacgaccttgggtgtgccggaagttcgcgtgattgcg
ccaaaaacgttgctcccgacgatggtcgaaaatctcggcgtacgggtttatcacgacatg
gctcagggcttgcgtgacgtcgatgtggtgctgatgctgcgcttgcagaacgagcgtatg
cagggcgcggcgctgccatccggccaggaatactttaaaaattacgggctgaccgaagaa
aagctcgcatatgccaaaccggacgccatcgtcatgcatccgggacccatgaatcgcggc
atcgaaattgattcgcgcgtggcggacgggatgcaatcggtgatcctgtcacaagtgacc
ttcggtatcgcagtgcgcatggcggtgatgagcacgctggctgggagcaataaatga

DBGET integrated database retrieval system