KEGG   Gallionella capsiferriformans: Galf_0137Help
Entry
Galf_0137         CDS       T01295                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00240  Pyrimidine metabolism
gca00250  Alanine, aspartate and glutamate metabolism
gca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Galf_0137
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Galf_0137
Enzymes [BR:gca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Galf_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADL54182
UniProt: D9SIC5
Position
165593..166549
Genome map
AA seq 318 aa AA seqDB search
MKNPQLNKHGELQHLLTTEGLPVRIMRDILDRAATFLDIDEGREIKKVPLLHGKSVFNVF
FENSTRTRTTFEIAAKRLSADVVNLNIGSSSTSKGETLLDTVDNLCAMHADMFVVRHSQS
GAAHLIARHVAPEIHVINAGDGRHAHPTQALLDMFTIRHYKKEFHNLRVAIVGDVLHSRV
ARSQIHALTTLGVPEVRVIAPKTLLPTMVENLGVRVYHDMAQGLRDVDVVLMLRLQNERM
QGAALPSGQEYFKNYGLTEEKLAYAKPDAIVMHPGPMNRGIEIDSRVADGMQSVILSQVT
FGIAVRMAVMSTLAGSNK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatccgcaactcaataaacacggtgaactgcagcatcttctgaccacggaaggc
ttgccggtacgcatcatgcgcgacattctcgaccgtgctgccaccttcctcgatatcgac
gaggggcgcgaaatcaagaaagtgccgctcttgcacggcaagtcggtattcaatgtgttc
ttcgagaacagtacccgtacccgcaccacttttgaaatcgccgccaagcgcctgtctgct
gacgtggtcaatctgaacatcggatcgtcctccaccagcaagggtgaaacgctgctcgat
acggtcgacaatctgtgcgcgatgcatgccgacatgttcgtagtgcgccattcgcaaagc
ggtgcggcgcatctgatcgcgcggcatgtcgcgccggaaattcacgtcatcaatgccggt
gacgggcgtcatgcgcatccgacgcaagccttgctcgacatgttcaccatccgtcattac
aagaaggaatttcacaatcttcgcgtagcgatcgtaggcgatgtgttgcattcgcgtgtg
gcgcgctcgcaaattcatgcgctgacgaccttgggtgtgccggaagttcgcgtgattgcg
ccaaaaacgttgctcccgacgatggtcgaaaatctcggcgtacgggtttatcacgacatg
gctcagggcttgcgtgacgtcgatgtggtgctgatgctgcgcttgcagaacgagcgtatg
cagggcgcggcgctgccatccggccaggaatactttaaaaattacgggctgaccgaagaa
aagctcgcatatgccaaaccggacgccatcgtcatgcatccgggacccatgaatcgcggc
atcgaaattgattcgcgcgtggcggacgggatgcaatcggtgatcctgtcacaagtgacc
ttcggtatcgcagtgcgcatggcggtgatgagcacgctggctgggagcaataaatga

DBGET integrated database retrieval system