KEGG   Gallionella capsiferriformans: Galf_0155Help
Entry
Galf_0155         CDS       T01295                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gca  Gallionella capsiferriformans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Galf_0155
Enzymes [BR:gca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Galf_0155
Exosome [BR:gca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Galf_0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
185419..186420
Genome map
AA seq 333 aa AA seqDB search
MQTLGQYPNKRMRRMRHDAFSRNLMRENVLTSADFIYPVFVLEGTNTVEDIKSMPGVQRK
TLDLLLKDAEACVKLGIPVMAIFPVVDASKKSLDAREAYNPDGLVPRVVATLKKHYPELG
IMTDIALDPYTSHGQDGLIDEAGYVLNDETIAVLTRQAQTHAAAGADIVAPSDMMDGRIG
AVRAALDEHGHIHTRIMAYSAKYASSFYGPFRDAVGSSTNLGAGNKYTYQMDPANSDEAL
WEVGMDLQEGADMVMVKPGMPYLDILRRVKDEFKAPTFVYQVSGEYAMLKAAAQNGWLNE
EACVLESLLAFKRAGADGILTYFALDAARWLQK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgcagacactaggacaataccctaacaaacgcatgcgccgcatgcgccatgatgctttc
tcacgcaatttgatgcgcgagaatgtgctgacatccgcagattttatttatcccgttttc
gtactggaaggcaccaatacggttgaggatatcaaatccatgcctggcgtacagcgcaag
acgctggatttgctgttaaaggatgcggaggcgtgcgttaaactaggtataccggtgatg
gcgatttttccggttgttgatgcgtccaaaaaatcactcgatgcgcgggaggcctacaat
ccggacggattggtgccgcgtgtcgtggcgacgctgaaaaagcactaccctgaactcggc
atcatgaccgacatcgcacttgatccttataccagtcacgggcaggacggcctgatcgat
gaggcaggttatgtacttaacgatgaaaccatcgccgtgctgactaggcaggcgcaaacg
catgccgcagcgggtgctgatatcgtcgcgccctccgacatgatggacggtcgcatcggt
gcggtgcgtgcggcgttagatgagcacggacatatccatacccgcatcatggcgtactcg
gccaaatatgcatcgagcttctatggtccgttccgcgatgcggtcggctccagcactaac
ctcggtgcggggaacaaatacacttatcaaatggatccggcgaattccgacgaagcgctg
tgggaagtcggcatggatttgcaggaaggtgcggacatggtcatggtcaagcctggcatg
ccttatctggatatcctgcgtcgcgtcaaagatgagtttaaagcgcccaccttcgtctat
caggtcagcggagaatatgcgatgctcaaagcggcagcgcaaaacggctggttgaatgaa
gaggcgtgtgtgctcgaatcactgttggcctttaagcgtgcgggagcggacgggattttg
acctactttgcgctggatgcggcaaggtggctgcaaaaatag

DBGET integrated database retrieval system