KEGG   Gallionella capsiferriformans: Galf_0389Help
Entry
Galf_0389         CDS       T01295                                 

Definition
(RefSeq) guanylate kinase (EC:2.7.4.8)
  KO
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gca  Gallionella capsiferriformans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Galf_0389
Enzymes [BR:gca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Galf_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(442206..442823)
Genome map
AA seq 205 aa AA seqDB search
MSGSLFVISAPSGAGKTSLVHALLATNPQIDLSVSYTTRAPRKGEVDGVAYHFVSRETFI
EMSGRGEFLESAEVYGNFYGTSQNWIAQENAKDRDILLEIDWQGAQQVRQQFAECVSIFI
LPPSIAALEQRLTGRGTDHSDVIKQRMAAASNDVAHVAEFDYVIINDNLNEALKEFNAIV
LAARLRGTKQLARHQNLINQLQNPE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaagtttattcgtcatcagtgcgccgtctggcgccggaaaaaccagtctggtg
cacgccttgctcgccaccaacccgcagattgatttgtccgtctcctacactacccgtgcg
ccacgcaaaggcgaggtggatggtgtcgcctaccactttgtcagccgcgaaacattcatc
gagatgtcaggacgcggcgagtttttggaaagcgccgaagtctacggaaatttttacggc
acctcgcaaaactggatcgcgcaggaaaacgccaaagaccgcgatattttgctggaaatc
gactggcaaggcgcccagcaggtcaggcagcagttcgctgaatgcgtcagcattttcatc
ctgccgccttccatcgcagcactggaacaacgactgaccgggcgcggcacagatcacagt
gacgtcataaaacaacgcatggcagcagcaagcaacgatgtcgcacatgtagctgaattc
gattatgttatcatcaacgataatctgaacgaggcgctcaaggaattcaacgcgatcgtt
ctggccgccagactgcgcggcaccaagcagttggctcgccatcaaaatttaattaaccag
ttacaaaatccggagtaa

DBGET integrated database retrieval system