KEGG   Gallionella capsiferriformans: Galf_0418Help
Entry
Galf_0418         CDS       T01295                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
gca  Gallionella capsiferriformans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gca00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:gca00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(468787..469272)
Genome map
AA seq 161 aa AA seqDB search
MSPCIVVAMAKNRTIGVNNTLPWRCPEDLKHFKTLTMGHHMIMGRKTFDSIGKPLPGRTT
VVVTRDRNLKIDGCLIAHSLPEALAACSDEPVFIVGGAEIYAQALPLADTLYITEIQQDV
AGDAHFPNFDPSAWQEVAREIRTQELPQPLEYHFVTYRRAT
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcccctgcattgtggttgccatggcgaaaaaccgcaccataggcgtgaacaacacg
ctgccctggcgctgccccgaggatctaaagcattttaagacgctcaccatgggccatcac
atgatcatgggccgcaagaccttcgattcgatcggcaaacccttgcccgggcgtaccacg
gtggttgtcacccgcgacagaaacctcaagatcgacggctgtttgatcgcacactcgctg
cccgaagcactcgctgcctgttctgatgaacctgtattcatcgtgggcggggccgagatt
tacgcgcaagccttaccgctggccgacacgctatacatcaccgagattcagcaggatgtt
gcgggggatgcgcatttcccaaattttgatccgtccgcatggcaggaagtcgcacgcgaa
attcgcactcaggaattgcctcagccgctggaatatcatttcgttacttatcgcagggca
acatga

DBGET integrated database retrieval system