KEGG   Gallionella capsiferriformans: Galf_0426Help
Entry
Galf_0426         CDS       T01295                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gca01100  Metabolic pathways
gca01110  Biosynthesis of secondary metabolites
gca01130  Biosynthesis of antibiotics
gca01230  Biosynthesis of amino acids
Module
gca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Galf_0426
Enzymes [BR:gca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Galf_0426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADL54470
UniProt: D9SJX1
Position
477711..478499
Genome map
AA seq 262 aa AA seqDB search
MSDILNKILAVKAQEVAAARAIKPLELLRSEAEHVAPARDFVAAVRAKIAAGKSAVIAEI
KKASPSKGVLRADFNPAAIAVSYEAHGAACLSVLTDAQFFQGCPEYLKLARAACHLPVLR
KDFIVDEYQIYQARAMGADAILLIAAALDLATMQAFEALAHRLGMAVLVEVHNSIELDAA
LQLTTPLIGVNNRNLRTFEVSLQNTLDLLPRIGSDRIVVTESGILNSTDVALMRANKVDC
YLVGEAFMRADNPGEELEKVFL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacatattgaataaaattctggctgtgaaagctcaggaagtcgccgcggcacgc
gccatcaagccattagagctgctgcgtagcgaggcggaacacgtcgcacctgcgcgagat
ttcgtggcggctgtacgcgcaaaaattgcagcgggaaagtcggccgtgatcgccgagatc
aagaaggccagtcccagcaaaggtgttttaagggcggattttaatcccgctgcgattgcg
gtcagctatgaggcacacggggccgcttgcctgtcggtgttgactgatgcgcagtttttt
cagggatgtcccgagtatctaaagctggcgcgtgccgcctgtcatctgcctgtattgcgc
aaggattttatcgtcgatgaataccagatttatcaggcgcgcgcgatgggagcggatgcg
atattgctgattgccgccgcgctcgatcttgcaacgatgcaggcattcgaggcgctggcg
catcgtctcggtatggcggtgttggtcgaagtgcacaattcgattgagctcgacgcagca
ctccaattgacgacgcctttgatcggggtgaataaccgcaatctgcgcacctttgaggtg
agtctgcaaaatacgctggatcttttgccccgtatcggcagtgatcgcattgtggtcacc
gaaagcgggattttaaattccaccgatgtcgcgctgatgcgcgcgaataaagtggactgt
tatctggtcggcgaggcgtttatgcgcgccgacaatccgggtgaggagctcgaaaaagta
tttttgtaa

DBGET integrated database retrieval system