KEGG   Gallionella capsiferriformans: Galf_0484Help
Entry
Galf_0484         CDS       T01295                                 

Definition
(GenBank) Cellulase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
gca  Gallionella capsiferriformans
Brite
Enzymes [BR:gca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Galf_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(528558..529712)
Genome map
AA seq 384 aa AA seqDB search
MSNSSIYLCGALRFAAFLLIFTLTSYAHAATCDTSWPEWDAFKKNLINENGRVVDGSAKD
SHTTSEGQSYALFFSLVANDKTTFEKLVNWTEKNLSKEDIITHLPSWILGKKEDDSYGVL
DTNSASDSDLWIAYTLGEAGRLWENRRYVALSSLLANRILKNETLDIPGLGTVLLPGAVG
FTPTTTSVRLNPSYAPLQLIHWFNTHSNDPRWASLLSSSKELIVKSSIKGYAPDWTIYQY
NKGFQPDTGNERAGLGSYDAIRVYLWAGMLNKDSPEYKNIMAALKPMAKLVEKMGVPPEF
VHVDSGDVHGQGSSGFSAAMVPFLMAEGYDKAAEQQLMRIDAQPIAKDSYYDQVLILFAL
GWQKDLYRFDSKGNLAPRWKSKCQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatagttcaatatatctctgcggcgcactgcggtttgcggcattcttattgatc
ttcactctgacctcttacgcacacgcggcaacgtgtgatacatcatggccggaatgggat
gccttcaagaaaaacctgatcaacgaaaatggtcgcgttgtcgacggcagcgcaaaagat
tcgcacacgacctcagaaggacaatcctatgcgctgtttttttcgctggtagctaatgac
aaaaccactttcgagaagcttgtgaactggacggaaaaaaatctttccaaagaagacatc
atcacgcatttaccctcctggatactgggcaaaaaggaagacgacagctacggcgtactg
gatactaattctgcctccgactccgacctgtggatagcctatacactaggtgaagctggc
agactatgggagaaccgccgctacgtcgcgctctcttctctgctggccaaccgtatactc
aaaaatgagacactcgacataccagggctgggtaccgttttattgcccggcgccgtcgga
ttcaccccgacgaccaccagcgtacggttaaatccaagctacgcgcctctgcaactgata
cactggtttaacactcacagcaacgatccccgctgggcctcgttgctgagctcatcgaaa
gagttgatcgtaaaatcgtcgatcaaaggctacgcacccgactggacgatttaccaatac
aacaagggatttcagcccgacacgggcaatgagagagcgggactgggttcgtacgacgca
atccgtgtctatctttgggccgggatgctgaacaaagacagccctgagtataaaaacata
atggccgccttaaaaccgatggcaaaactggtcgaaaaaatgggtgtcccacccgaattt
gtccatgtagattcaggagatgtccatggtcagggatcaagcggattttcagccgccatg
gtgccatttctgatggccgaaggctatgacaaggccgcagaacaacaactcatgcgcatt
gatgcgcaacccattgcaaaagatagttattacgatcaagtattaatcttgtttgcgctc
ggctggcaaaaagacttataccggtttgattcaaaaggaaacctagccccaagatggaag
tcaaaatgccaataa

DBGET integrated database retrieval system