KEGG   Gallionella capsiferriformans: Galf_0500Help
Entry
Galf_0500         CDS       T01295                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gca  Gallionella capsiferriformans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Galf_0500
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Galf_0500
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Galf_0500
Enzymes [BR:gca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Galf_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
547401..548201
Genome map
AA seq 266 aa AA seqDB search
MSRIQAAFEKLKQQQRRALIPFFTAGDPSPSVTVPLMHALVSSGADVIELGVPFSDPMAD
GPTIQRASERALKQGMSLRGVLDLVAEFRRTNDATPVVLMGYGNPIEAMGWAKFAQRCAD
VGVDGVLTVDFPPEESSEAFEHLQRHGIDPIFLLAPTTEEARIKQVAKLARGYVYYVSLK
GVTGSGSIDLSAIEQKLPLLRQHIKLPIGVGFGIRDAATAKAVASLCDGVVVGSRIVQVI
EDSNEANVVDNVSALIKELRLAVDQA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcatacaggccgcgttcgagaaactcaaacaacagcagcgccgcgcgctgatc
ccattttttacggcaggcgacccgagtccgtctgtgaccgttcccttgatgcatgcgttg
gtatcatccggtgctgatgtgatcgaactgggtgtgccgttttcagatccgatggcagat
ggcccgaccattcagcgtgcttcagagcgcgcgctcaaacagggtatgtcgctgcgtggt
gtgctggatctggtcgctgaatttcgccgtaccaatgatgcaacgcctgtcgtattgatg
ggctacggcaatccgatcgaggcgatgggctgggcgaaatttgcacaacgctgcgctgat
gtcggtgtggacggcgtgctgacggtcgattttccgcctgaagagagcagtgaagccttc
gaacatttgcagcgtcacggcattgatcccatctttttgctggcgccgaccactgaagag
gcgcgcatcaagcaggtcgcaaagcttgcgcgcggttatgtgtattatgtgtcgctcaag
ggggtcacaggatcaggcagcattgatctgtcggccatcgaacaaaaattacccctgttg
cgtcagcacatcaaactaccaatcggggtaggttttggtatacgcgatgcagcgacggcc
aaagcggtcgccagtctgtgtgacggggtggtggtgggaagtcgtattgttcaagttatt
gaagattcgaatgaagcgaacgtggtcgataacgtaagtgcattgattaaagaattaagg
ctggctgtagatcaggcctaa

DBGET integrated database retrieval system