KEGG   Gallionella capsiferriformans: Galf_0500Help
Entry
Galf_0500         CDS       T01295                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gca  Gallionella capsiferriformans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Galf_0500
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Galf_0500
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Galf_0500
Enzymes [BR:gca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Galf_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
547401..548201
Genome map
AA seq 266 aa AA seqDB search
MSRIQAAFEKLKQQQRRALIPFFTAGDPSPSVTVPLMHALVSSGADVIELGVPFSDPMAD
GPTIQRASERALKQGMSLRGVLDLVAEFRRTNDATPVVLMGYGNPIEAMGWAKFAQRCAD
VGVDGVLTVDFPPEESSEAFEHLQRHGIDPIFLLAPTTEEARIKQVAKLARGYVYYVSLK
GVTGSGSIDLSAIEQKLPLLRQHIKLPIGVGFGIRDAATAKAVASLCDGVVVGSRIVQVI
EDSNEANVVDNVSALIKELRLAVDQA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcatacaggccgcgttcgagaaactcaaacaacagcagcgccgcgcgctgatc
ccattttttacggcaggcgacccgagtccgtctgtgaccgttcccttgatgcatgcgttg
gtatcatccggtgctgatgtgatcgaactgggtgtgccgttttcagatccgatggcagat
ggcccgaccattcagcgtgcttcagagcgcgcgctcaaacagggtatgtcgctgcgtggt
gtgctggatctggtcgctgaatttcgccgtaccaatgatgcaacgcctgtcgtattgatg
ggctacggcaatccgatcgaggcgatgggctgggcgaaatttgcacaacgctgcgctgat
gtcggtgtggacggcgtgctgacggtcgattttccgcctgaagagagcagtgaagccttc
gaacatttgcagcgtcacggcattgatcccatctttttgctggcgccgaccactgaagag
gcgcgcatcaagcaggtcgcaaagcttgcgcgcggttatgtgtattatgtgtcgctcaag
ggggtcacaggatcaggcagcattgatctgtcggccatcgaacaaaaattacccctgttg
cgtcagcacatcaaactaccaatcggggtaggttttggtatacgcgatgcagcgacggcc
aaagcggtcgccagtctgtgtgacggggtggtggtgggaagtcgtattgttcaagttatt
gaagattcgaatgaagcgaacgtggtcgataacgtaagtgcattgattaaagaattaagg
ctggctgtagatcaggcctaa

DBGET integrated database retrieval system