KEGG   Gallionella capsiferriformans: Galf_0500Help
Entry
Galf_0500         CDS       T01295                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00260  Glycine, serine and threonine metabolism
gca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gca01100  Metabolic pathways
gca01110  Biosynthesis of secondary metabolites
gca01130  Biosynthesis of antibiotics
gca01230  Biosynthesis of amino acids
Module
gca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Galf_0500
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Galf_0500
Enzymes [BR:gca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Galf_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ADL54544
UniProt: D9SC79
Position
547401..548201
Genome map
AA seq 266 aa AA seqDB search
MSRIQAAFEKLKQQQRRALIPFFTAGDPSPSVTVPLMHALVSSGADVIELGVPFSDPMAD
GPTIQRASERALKQGMSLRGVLDLVAEFRRTNDATPVVLMGYGNPIEAMGWAKFAQRCAD
VGVDGVLTVDFPPEESSEAFEHLQRHGIDPIFLLAPTTEEARIKQVAKLARGYVYYVSLK
GVTGSGSIDLSAIEQKLPLLRQHIKLPIGVGFGIRDAATAKAVASLCDGVVVGSRIVQVI
EDSNEANVVDNVSALIKELRLAVDQA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcatacaggccgcgttcgagaaactcaaacaacagcagcgccgcgcgctgatc
ccattttttacggcaggcgacccgagtccgtctgtgaccgttcccttgatgcatgcgttg
gtatcatccggtgctgatgtgatcgaactgggtgtgccgttttcagatccgatggcagat
ggcccgaccattcagcgtgcttcagagcgcgcgctcaaacagggtatgtcgctgcgtggt
gtgctggatctggtcgctgaatttcgccgtaccaatgatgcaacgcctgtcgtattgatg
ggctacggcaatccgatcgaggcgatgggctgggcgaaatttgcacaacgctgcgctgat
gtcggtgtggacggcgtgctgacggtcgattttccgcctgaagagagcagtgaagccttc
gaacatttgcagcgtcacggcattgatcccatctttttgctggcgccgaccactgaagag
gcgcgcatcaagcaggtcgcaaagcttgcgcgcggttatgtgtattatgtgtcgctcaag
ggggtcacaggatcaggcagcattgatctgtcggccatcgaacaaaaattacccctgttg
cgtcagcacatcaaactaccaatcggggtaggttttggtatacgcgatgcagcgacggcc
aaagcggtcgccagtctgtgtgacggggtggtggtgggaagtcgtattgttcaagttatt
gaagattcgaatgaagcgaacgtggtcgataacgtaagtgcattgattaaagaattaagg
ctggctgtagatcaggcctaa

DBGET integrated database retrieval system