KEGG   Gallionella capsiferriformans: Galf_0805Help
Entry
Galf_0805         CDS       T01295                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
gca  Gallionella capsiferriformans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Galf_0805
Enzymes [BR:gca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Galf_0805
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Galf_0805
Lipid biosynthesis proteins [BR:gca01004]
 Fatty acid synthase
  Component type
   Galf_0805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(856047..856682)
Genome map
AA seq 211 aa AA seqDB search
MKNFTPQILFIFRTALLLVALSLPFATQAAPQKSILIFGDSLSAGYGLDIAESWPSLLQL
QLDSSRSGFKIINASISGETSLGGRQRLARLLEQYKPAIVIVELGANDGLRGFSTADIES
NLNDIMVQLKQPQIKTLLIGMKLPPNYGEPYISQFQSMFPRIAAKNRVSLLPFLLDGVGA
EQFQADNLHPAAASQPQVMRNVLQALKPLLR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttaccccgcaaattttatttatcttcagaactgcgctgctgctagtcgca
ctcagcctgcccttcgccacacaggccgcgccgcaaaaaagtattttgatatttggtgac
agcctgtcggctggctacggactggatatcgcagagagctggcccagcctgttgcaactt
cagttggatagcagccgctcgggcttcaaaatcatcaacgccagcatcagcggcgaaacc
tcattgggtggccgccagcgtctggcccggctgctggaacaatataagcccgcgatcgtc
atcgtggaattgggtgccaacgacgggctgcgcgggttcagcaccgccgacatcgaaagc
aacctgaatgacatcatggtacaactcaaacaaccacagattaagaccttgctgatcggc
atgaagcttccgcccaattacggcgaaccctatatcagtcagtttcagagcatgttcccg
cgtatcgccgcaaaaaatcgcgtcagcctactgccctttctgcttgacggcgtcggtgca
gagcagtttcaggccgacaatctgcaccccgcagccgcctcacaaccccaggtcatgcgc
aacgtactgcaagccttaaagcccctgttgcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system