KEGG   Gallionella capsiferriformans: Galf_1102Help
Entry
Galf_1102         CDS       T01295                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
gca  Gallionella capsiferriformans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1168812..1170611)
Genome map
AA seq 599 aa AA seqDB search
MNKPNPSEVARETLKMLAQRRLIPTPDNYAKIFTEISGGPAIETNGAAKVLRNVVEHLLQ
TDKAAGTGLALKKMLGEENWDKCFKEIEKVLPKTHKSDAPEQTWPVLIRDLLRQIDLPHK
GLTVSRKKESLETVLARFASDPDILFEKLGKLIRSWSESATTDSLIEHPELNVAHPALPP
ATTPATEPKSAASDASTIKSQAAEMLEKLKELLAHALEGTLSAQPELAEEIGQLTAQVRQ
IKTCDEVTELAKQLHNFWLKVELRSSDKSRIQDGLVRLLRLLVENVGEMIEDEEWLHGQV
NTLHTIIENPIDKYVIADAERSLREAIIKQGLLKKSLVDAKSTLKSLMTTFIDRLGIITV
STGDYHQKISGYSEKIAQSSNLNDLGHLLDDIMQDTRVIQASALKSHEELLDSRKQVESA
EEKISKLEKELSEVSELVHQDQLTGALNRRGLDAAFDRESRRVDRSHESLCIALLDIDNF
KRLNDTMGHQVGDKALIHLCHVIKEALRPSDSVARYGGEEFVLILPDVTLAEAALTVERL
QRELTKQFFMHENDRILVTFSAGVAQLAPNESQEELIGRADKAMYQAKQTGKNRVVVAN
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaataagccaaacccgtcagaagttgcccgcgaaaccctaaaaatgctggctcaacgc
aggctcataccgacccctgacaattatgcaaaaatttttactgagatcagcggcgggcct
gccatcgagacgaatggtgccgcaaaagttttgcgcaatgtggtcgaacatctactgcaa
accgacaaagccgccggtaccggactcgccttaaaaaaaatgttgggcgaggaaaactgg
gacaaatgctttaaagaaattgaaaaggtactccccaaaacccataagagcgatgcgccc
gagcagacttggccggttttaatccgggatttattgcgacaaattgacctgccgcacaaa
ggcctgaccgtttcacgcaaaaaggaaagtctagaaaccgtattagcacgctttgcatcc
gatcctgacatcctgtttgaaaagctaggcaaactgatccgctcatggtcagaatctgcg
accaccgacagtctaattgagcatccagaattaaacgtggcacatcccgcattgccaccg
gcaactaccccagcgacagaaccgaaatccgctgcctcagacgcctcgactatcaaaagt
caagcagcagaaatgcttgaaaaactcaaagagctgctcgcacacgcgctggagggtacg
ctcagcgcacaaccggaactcgcagaggaaatcggccagctcaccgcacaagttcgccag
atcaaaacctgcgatgaggttacagagcttgccaaacaattacacaatttctggctgaag
gttgagttacgcagcagtgacaaatccagaattcaagatggcctggtgcgtctgctgcgt
cttttagttgaaaacgtcggcgaaatgatcgaggatgaagaatggctgcacggtcaggtg
aacacgctgcacaccattattgaaaatccgatcgataaatacgtgatcgcagatgccgag
cgcagcctgcgtgaagccatcattaaacaaggattactcaaaaagagtctggttgacgca
aaatcaacgctcaagagtttaatgaccaccttcattgaccgactgggcatcatcacggtc
agcacgggcgactatcaccagaaaatatcaggttacagtgaaaagatcgctcaatcgagc
aacctgaatgatcttggtcacttgctcgacgacatcatgcaagatacccgggtaatacaa
gctagcgcgcttaaatcgcatgaggaattgctcgattcacgcaaacaggtcgaaagtgcg
gaagaaaaaatttctaaactggaaaaggaactctccgaagtgagcgaactggttcatcag
gatcagctgaccggcgcattgaaccggcgcggcttagatgcggcctttgatcgcgaaagc
cgccgcgtggaccgcagccacgaatcgctgtgcattgcgctgctggacatcgacaacttc
aaacgactgaacgacaccatgggtcatcaagtaggtgacaaagcactgattcatctgtgc
cacgtcatcaaggaagcactgcgcccctctgactcggtcgcccgttacggcggcgaggaa
ttcgttctgatactccccgatgtcactctggcagaagcggcgttaacagtggaacgccta
caaagggaactcaccaaacagttcttcatgcatgaaaacgaccgtatcctcgtcaccttc
agtgcaggggtcgcacaactggctccgaatgaatcgcaggaagaactgattggacgcgca
gataaagcgatgtatcaggcaaaacagaccggaaaaaaccgcgtcgtcgttgccaactaa

DBGET integrated database retrieval system