KEGG   Gallionella capsiferriformans: Galf_1119Help
Entry
Galf_1119         CDS       T01295                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gca  Gallionella capsiferriformans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1188393..1189055
Genome map
AA seq 220 aa AA seqDB search
MTMRHSGIGMTSARTRQRMIDRLRDQGIVDEAVLAAMYEVPRHLFVDEALASRAYDDVSL
PINYEQTISQPYIVARMIEVLRASTTRPIKKVLEIGTGCGYQAAVLAHVFPEVYSMERIE
PLYQRAKSKLHDLAINNVKLSYADGSAGLPDAALFDGIIMAAAAPVMLAALREQLAVGGR
MVLPVGRQEQWLYLVEREAQGFRESRLEPVKFVPLLMGKA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgactatgcggcatagcggtatcgggatgacctctgcacgaacacggcagcgcatgata
gaccgtctgcgggatcaggggatcgtcgatgaggccgtgctggcggcgatgtatgaagtg
ccgcgacacctgtttgtcgatgaggcgctggcaagccgtgcctatgacgatgtgtctttg
ccgatcaactatgaacaaacgatttcacagccttatatcgtcgcgcgcatgatagaagtg
ctgcgcgcctcaacgacgcgtccgattaaaaaagtgctggaaatcggcaccggttgcggg
tatcaggcggctgtactggcgcatgtgtttcccgaggtgtacagcatggagcgcatcgag
cctttgtatcagcgcgctaaaagtaaattgcacgatcttgcgatcaacaatgtgaagttg
agctatgcggacggctcggcgggtctgcctgatgcggcgcttttcgatggcatcatcatg
gccgcagccgcgcccgtgatgctggcggccttgcgcgagcagctggcagtgggcgggcgt
atggtgctgccggtcggccggcaggagcagtggttgtatctggtcgagcgcgaggcgcag
ggattccgcgaatctcgtctcgagccggtaaaatttgtacctcttttgatgggaaaagca
tga

DBGET integrated database retrieval system