KEGG   Gallionella capsiferriformans: Galf_1132Help
Entry
Galf_1132         CDS       T01295                                 

Definition
hypothetical protein
Organism
gca  Gallionella capsiferriformans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1203838..1210386
Genome map
AA seq 2182 aa AA seqDB search
MSSTFKFRLVDNDSEEYLAQSQAIQEARAHQEAEMQAGFTAQARARAEAHGRAIAQARVR
MEMELIAQLEAKCQDETRLSEVAQERLEVEKQLSHELREKLLAEMRLQEENQARLRAEIQ
AQEALSQRVESEQIARAAAENKIRAEKELQALISRQYQAEQNSLQRAEAEIRALRVETEK
LEAQVEQEVGERMRAEQLQHAQAAEKLEIETRLNEAARLRVENEAEELRLARVRADIDQH
EMALIAKRLDAERGAAKAAENRSRLEQQAATLAQEKITTDHTIARVLQEKVSQEQKVVTL
LAAKLDTEQIAKEALQARVSAESLALAEVEAKLKAERDAEQAALLRASTEQLAIVAANQR
KQAEEQMRLEAEARVQTERQAYKAARQHTQAELDARSEAERKLRAEEEVARLLQEQADVD
KKLADQQEQTQASLLQAVRDANERLNSESLASQAAAQKLATGRDQLVFAQQRAETEIEAA
QALELQLQTEAAAIAIASERLLAAEKAQQAAEEKARIESELLETARQCEQAERLAEQQLR
EKYQLQNAALQAAQLRAEALAREKLLVEQNLQAEHKLIETAAEKAQAAELANEAAVRRAQ
IELEALHTAKIQLETETRAIAQIEATMAAQLQATEADNLRIEMEARAQSAALTTLELNEQ
ANRDAGAQELAAVRALNIARLRAETEARALKLKEDLIRAEAMATAALKKQMDDAQLLHEE
TVQRAEHMVARRIQEEQRATALEEERIRSEARASVAAAQHARAERAAVEAAIEREQIALQ
LVGQEQLREAEERQLQSQMVLRATLEAEAVAALQARLAAEQQACEAEQEKIAAAQQATSI
ALAHEAAQRQLALAQQEKNSSEAAAVAAMNHLEALAATARQVAQEREQMAQRLAEREQQR
LAEERELSVQLEKRVDLEMEAAESVKVRLATEQLACEVQQEKIKAEQQARELAAAREASE
RELLAVEQALLRSEESAVQIMQERTRVAEEARVAAQQRELAAQLLVEQEQQRLADELRLQ
AEVERRAALEAEVAVAVAARLAAEEQATDAEQLKILAEHQVRALALEHEAAQGLLIEAAQ
EKMRLEEQVVAAINGQVSQAQQLNEQEAARLAGELQLQEQGELRVALEAAAASAVLARLA
AEEKACELEREKISIAQLARNRALEAEAAHARAIDAEQEQMRCEDLALAAAKLHVQTAEE
AALSARAREQLALQMQEQELLHLQAEQQLQTEVAQCLALEVEAVAALQARLASEQRAGEL
EQEKINAQQQAHQLAVAREAAERQAIAVEQDAIRIEASAIVAAQQQRELAEQARQVAYER
EQLALQLREQEQQRLSHEQQLQAQLEQHAALEVVAFEALQARLAAQTLACEAEQLKVVLE
QQAQQLARDNEAALRHAADLEQEKINREAAALAATQQHIQISEQARLAAIDREQLEHQLA
EQAARQLELERILQERAALQASLADAAERETQVRIDAEQRACEAQQLQIAVQQQAQQMAL
EHDAVMRHAADSEQQKIASLALALTAEQQRIEIAEQARLASLARAELENKLAGQAAQQLE
LERNLQAQQELSLSLAEAAARETESRIDAEQRAADAERHKIAAEQQAQQVACEQEAALQQ
ALAAEQQKMVADALALTATQQRIEMTEQARLAGVEREALEQQLAADVARQLALEQDLQAG
IAQQRALALALECESAARIEALQRANEIEQSKIAAEQEALRLAHAHEQVRRRLVAAEQEK
NRREELAIRAVGEHEQLIQTITQAAIEREQQAQQLQEKESLRLAHERELQVLLAEHIEKE
AAAAEAVRAEQLALQLACAAEQEKIETLNQAVQLAQTRVAHEREALLVEQEQVRCESALM
AAVEERAKIAEAAIESVKAREQIENQLAREAQLQIERDRMLEERLAYKQTMAENVAKSRQ
DRIDAEQRLIAGEQHKAEVERQAMMDAEERLNLLRMQAEEAAEIAAQISAQREALQQRAV
EAERAKAQAEQQALQEDAERLALIEQAAQIAQQRQQEQQQLRLEQQSRLEAEALLLSETA
QRVAAEREAFEAVAVHMTAEQRATVEAQEKIALEKQAAVHAQQLAEYDEQKNMALRSYVE
QTRIELEPYYSKAQLQKRRLFVKVGVLAGGGLLAALLGWQLLNTRNATPARLVKAVPPKA
FEADEASLQLGSLKLSKQLQQK
NT seq 6549 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccacttttaaatttcgtttggtcgacaacgacagcgaagaatatctcgctcag
tctcaggcgatacaggaagcccgcgcgcatcaggaagccgagatgcaggcgggttttacg
gcccaagcgcgagcacgcgccgaagcacatggacgcgccatcgctcaggcgcgcgttcgt
atggaaatggagttgattgctcagctcgaagcgaagtgccaggatgagacccgtttgtcg
gaagtcgcgcaggaacggctcgaagttgaaaagcagttatcccatgaattgcgcgaaaaa
ctgctcgctgaaatgcgtttgcaggaagaaaatcaggccagattgcgcgctgaaattcag
gcgcaggaagcgttgtcgcaacgcgtcgaatccgaacaaatcgcccgtgcggccgcagaa
aataaaattcgcgccgaaaaggagttgcaggctttaatttccaggcaatatcaggcggaa
cagaattccttgcagcgtgccgaggcggaaattcgcgcgcttcgggtggagaccgaaaag
cttgaggctcaagttgagcaagaagtcggtgaacgcatgcgcgctgagcagttgcaacat
gcgcaggcggctgaaaagctggaaattgaaacgcgcttgaatgaggctgctcgcttacgc
gttgaaaacgaagcagaggagctgcgactggcacgggtacgcgccgatatcgatcagcat
gaaatggcgctgattgccaagcgtctcgacgccgagcggggtgcggcaaaagcggcagaa
aaccgcagcagactggagcagcaggccgcaacgcttgcacaggaaaaaatcaccaccgac
cacacgattgcacgcgtgctgcaggagaaagtcagtcaggagcagaaggttgtcacgctg
cttgccgccaagctcgataccgaacagattgccaaggaagctttgcaggccagagtcagt
gccgagtcgctggcgctggcggaggtcgaagctaagctcaaagccgaacgcgatgcagaa
caggcggcgctgctgcgcgccagtactgaacaattagcgattgtcgcggcgaatcagcgc
aaacaggctgaagagcaaatgcgtctggaagcggaagcccgcgtacaaaccgagcgtcag
gcgtataaggccgctcgccagcatacacaggcggaactcgatgctcgcagcgaagcggaa
cgcaaactgcgggctgaggaagaggtagcccgtttgctgcaggaacaagcagacgtcgat
aaaaagctggccgaccagcaggagcaaacgcaggcaagtctgttgcaggcggtgcgcgat
gcgaatgaaaggctcaatagtgaaagtttagcctcacaggctgcggcacaaaagctcgcc
acgggccgtgatcagctggtatttgcccagcaacgcgccgaaaccgaaatcgaggcggct
caggcgcttgaattgcagttgcaaaccgaagcggctgccattgcgattgccagcgaacgg
ctgctcgccgcagaaaaggcgcaacaggccgcagaagaaaaagcacgcattgagagcgag
ttgctggaaacagcacggcagtgtgagcaggctgaacgcttggctgaacagcagttgcgc
gaaaaatatcagttacagaatgcggcattgcaggcggctcaattgcgcgcagaagcgctg
gcgcgcgaaaaattgctggtcgagcaaaacttacaggccgagcataagctgattgaaact
gcggcggaaaaagcgcaggccgcggaacttgcgaatgaagcggccgtgcggcgcgcacaa
attgaactcgaagcgctgcatacggcgaagattcagttggaaacagaaacgcgagcgatt
gctcaaatcgaagcgacgatggccgcgcagttgcaggcaactgaagcggacaatctgcgc
atcgaaatggaggcgcgtgcacaatcggccgccctgacgacgctggaattgaacgaacag
gcgaatcgcgatgccggggcgcaggaactggctgcggtgcgcgccctgaatattgcccgg
ttgcgcgctgaaacggaagcgcgggcgttgaagctcaaagaagatctgattcgcgcggag
gcaatggcgacggcggcgttgaagaagcagatggatgatgcacagttgctgcatgaggaa
actgtgcagcgcgccgagcatatggtggcgcgtcgtattcaggaagagcagcgtgccaca
gcgcttgaagaagagcgtattcgcagcgaagctcgtgcgtctgtcgccgcagcgcaacat
gcccgcgccgagcgtgcggctgttgaggcggccatcgagcgcgagcagatcgcgctgcaa
ctggtcgggcaggaacagttgcgcgaggccgaagagcgtcagttgcagtcacagatggtg
ttacgtgcgaccttagaggctgaagcggttgccgccttgcaggcaaggctcgccgccgag
caacaggcgtgcgaggctgagcaggaaaaaatagcggcagcgcaacaggcgacgtcaatt
gctttagcgcatgaagcggcacagcgtcagttggcgttggctcagcaggaaaaaaacagc
agtgaagcggccgccgttgcggctatgaatcatctggaggcgttggcggctacggcaagg
caggtggcccaagagcgcgagcagatggcgcagcgtttggccgagcgcgaacagcagcga
ctggccgaagagcgcgaattaagtgtgcaactggaaaaacgggttgaccttgaaatggag
gccgccgagtctgtcaaggtgcgccttgccactgagcagttggcctgcgaggtacagcag
gaaaaaattaaggcggagcagcaggcgcgcgagttagcggctgcgcgtgaggcttctgag
cgtgaactgctggcggttgagcaggcgttactgcgcagcgaagaatcggctgtgcagatc
atgcaggagcgcacccgcgtggcagaagaagcccgggttgcggcacagcaacgtgagctg
gctgcgcagcttctggttgagcaggaacaacagcggctggctgacgagcttagattgcag
gctgaagtcgaacggcgtgcagcactggaagcggaagtggctgttgcagtggcggcgcga
ctggcagctgaagagcaggcaaccgatgccgaacagctcaaaattcttgccgagcatcag
gtacgcgcattggcattggagcatgaagcggcacaggggctgctgattgaggccgcgcag
gaaaagatgcgtctggaagagcaagtcgttgcggctatcaatgggcaggtgtcccaagct
cagcagttgaatgagcaggaggccgcacgactggcaggtgaacttcaattgcaggaacaa
ggtgagctgcgtgttgcgctggaggccgctgccgcttctgccgtattggcacgcttggct
gccgaagaaaaggcctgtgagctcgaacgggagaaaatttcgatagcccagctggcgcgc
aatcgtgcactggaagctgaagcggcgcatgcgcgggcaatcgatgctgaacaggaacag
atgcgctgcgaggatttggcgcttgccgcagctaagttacatgttcagacagcagaagag
gccgcgctgagcgctcgtgcgcgcgagcagctagcgttgcagatgcaggagcaggagctg
ctgcatctgcaggctgagcaacaactgcagacggaagtcgcgcagtgtcttgcgttggag
gtggaagcggttgcggccttgcaagcgcgccttgcatccgagcagcgtgcgggtgagctg
gagcaggaaaaaattaatgcacagcagcaggcgcaccaactggctgtggcgcgtgaagcg
gcagagcgtcaggctattgccgttgagcaggatgcaatccgtattgaagcatctgcgatc
gtcgcagcccagcagcagcgtgaactggccgagcaggccagacaagtcgcgtatgaacgc
gaacaattggcattgcaattgcgcgagcaggaacagcagcgcttatcccatgagcagcag
ttgcaggcgcaactggagcagcatgcggcgcttgaagttgtagcttttgaagcgctgcag
gcgcgactggcggcgcaaaccctggcctgtgaagctgaacagctcaaggtcgtgttagag
caacaggcgcagcaattggcacgcgataatgaagcggcattgcgccatgcggcggatttg
gaacaggagaaaatcaatcgtgaagcagcggctttagccgccacgcagcaacatattcag
atatcggaacaggccaggcttgcggcgatcgatcgcgaacagctggagcatcagctggcc
gagcaagccgcacgccagttagagctcgaacgcattttgcaggagcgggctgcattgcag
gcgtctttggctgatgctgccgagcgtgagacgcaggtccggattgacgcggagcagcgt
gcatgcgaggcgcaacagctccaaattgcggtccagcagcaggcgcaacagatggcgctc
gaacatgatgcagtcatgcgtcatgcggcggattccgaacagcaaaaaatcgccagtctg
gcgctcgctttgacagctgagcagcagcgcattgagattgcagagcaggcacgtttggct
agtcttgcgcgtgcggagttggaaaataagcttgccgggcaggcagcgcaacaactcgaa
ctagagcgtaatctgcaggctcaacaggaactcagtttgtcactggctgaggccgcagcg
cgcgagactgagagcaggatcgatgcagaacagagagcagctgatgcagaacggcacaaa
atcgccgctgagcagcaggcacagcaagttgcctgcgaacaggaagccgcattgcagcag
gcattggctgcggagcagcagaaaatggttgctgacgcactcgctttgaccgcaacacag
cagcgcattgaaatgacagagcaggctagacttgcgggcgttgaacgcgaagcgctggaa
caacagctggcagcggatgtcgcacgtcagctggcgctcgaacaggatttgcaagcgggt
atcgcgcagcagcgagcactggcactcgcacttgagtgcgaatcagcggccagaattgag
gcgctgcagcgggcgaacgagattgagcagagcaaaattgcagccgagcaggaggcgctg
cgcttggcccatgcgcatgagcaggtcaggcgtcgcttggtcgcggctgagcaggaaaaa
aatcgccgtgaggaattggccatacgggcggtcggtgaacatgagcagttgatccagacg
attacgcaggcggccatcgagcgtgagcaacaggcgcagcagttgcaggagaaagagtcg
ctgcgactggctcatgagcgtgagttgcaggtattgctcgctgagcatattgagaaggaa
gccgccgctgcagaggccgtacgtgctgaacaattggcgctgcaattggcttgtgctgcc
gagcaggagaaaattgaaacgctcaatcaggctgtacagttggcgcagacgcgtgttgca
catgagcgtgaggcgcttctcgttgaacaggagcaggttcgttgcgagtctgctttgatg
gctgctgttgaagagagagcgaagattgcagaggctgccattgaatcggtgaaggcgcgc
gagcagatagagaaccagctcgcgcgtgaagctcagttgcaaatcgagcgtgaccggatg
ctggaggagcgtttggcctataaacaaaccatggcggaaaatgttgctaagtcacggcag
gatcgcattgacgccgagcagcgtttgatcgcgggcgagcagcacaaagcagaggttgag
cggcaggcaatgatggatgcggaggagcgtctgaacttattgcgcatgcaggcggaggaa
gcggccgagatcgctgcgcaaatcagcgcacagcgtgaggcgctgcagcagcgggcagtg
gaggcggagcgggctaaagctcaggctgaacagcaggcgctgcaagaggatgctgagcga
ctggcgttaattgagcaggcagcgcaaattgctcagcaacggcaacaggagcagcagcag
ttgcggctagagcagcagtcgcgccttgaggctgaagcgctgctcttgtcggagacagcg
cagcgagtggcggcggaacgcgaggcgtttgaggcggtggcagtgcacatgacggctgag
cagcgtgcaacggttgaagcgcaggaaaagatcgcgcttgaaaaacaggcagccgtccat
gcgcagcagttagccgaatatgatgaacaaaaaaatatggccttgcgcagctatgtcgag
caaactcgcatcgagttggagccatactactcaaaggctcagttacaaaaaagaaggctg
tttgttaaggtgggtgtgttggccggagggggcttgcttgcagcactgctgggctggcag
ttattgaatactcgcaatgcgacgccagccaggcttgtcaaagctgtgccacccaaagcg
tttgaggctgatgaagcatcgcttcaattaggctcacttaaactctccaaacaattacag
cagaaataa

DBGET integrated database retrieval system