KEGG   Gallionella capsiferriformans: Galf_1158Help
Entry
Galf_1158         CDS       T01295                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
gca  Gallionella capsiferriformans
Brite
Enzymes [BR:gca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Galf_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1244749..1245570)
Genome map
AA seq 273 aa AA seqDB search
MDTVKLVGGEHAVLLVHGLQGGPTEMLPLAKRLNQAGYSVYVPHFAGYGYHDGDTTHSVT
PWQDWHKLVLDEVAILKQTHTTVSLGGLCIGAVLALSVAADSGSDVAALSLLSTTLYYDG
WSIPWYRFVLPIGYYTPFRYFYSYSGRPPFGIKNEQLRKWVIREMNHKESSIAAVSNLCL
PAIHEAELLIKAVKARLPAIETPTLVIHATEDDVCSPRSAEYVMQHIGSKQRECVMLGNS
YHMITVDNDREQVASETIRFFNSTQAEKVSSLP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggatacagttaaattagttggcggcgaacacgcggtgttgctggtgcatggactgcaa
ggcggcccgacagaaatgctcccgctggcaaagcgcttaaatcaggcaggctactcggtg
tacgtaccgcactttgccggctacggttaccacgatggcgataccacgcattccgtcaca
ccctggcaggactggcacaaactggtcttagatgaagtggcgatcctgaagcaaacgcac
accaccgtatcactcggcggtctatgtatcggtgcggtcttagcgctgagcgttgcggca
gactcgggcagcgacgtcgcggccttgtctttactgagcacgaccctgtattacgacggc
tggagcatcccctggtaccgcttcgtgctgccgatcggctactacacgccgtttcgctat
ttttacagctattccggccgcccgccttttggcatcaaaaacgaacaattgcgcaaatgg
gtgattcgcgaaatgaatcacaaagaatcctcaattgccgccgtctcgaatctatgcctg
cccgccatacacgaggccgaattgctgattaaagccgtcaaagcacgcctgcctgcaatc
gaaaccccgacgttggtcatccacgcgacagaagacgatgtctgttcgccgcgcagcgcg
gaatatgtgatgcagcatatcggatcaaaacaacgggagtgcgtcatgttgggcaatagc
tatcacatgatcaccgtggataacgacagagaacaggttgccagcgaaaccatacgattt
tttaactcgacacaagctgaaaaagtcagctccctgccctga

DBGET integrated database retrieval system