KEGG   Gallionella capsiferriformans: Galf_1167Help
Entry
Galf_1167         CDS       T01295                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gca  Gallionella capsiferriformans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Galf_1167
Enzymes [BR:gca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Galf_1167
Transfer RNA biogenesis [BR:gca03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Galf_1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1261466..1262263
Genome map
AA seq 265 aa AA seqDB search
MFEKLLPQVVAIAVKAGQAIMEIYADPANVVMTKADDSPLTQADLAADKVIKAGLENLQL
GWPVLSEESAEIPYETRKNWPCFWLVDPLDGTKEFIKRNGEFTVNIALIENGEPVLGVVY
APVLDVCYFAARGVGAFIKRGAQASQPVGAKAALPGEVLKIVASRSHADERTAALLVKLG
EYECISMGSSLKLCLVAEGAAHLYPRLGPTMEWDTAAAHAVVACAGGRVCDWTGAELSYN
KPDLHNPEFLVIAEQDTKLLAKLIA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaaattgcttccccaggttgtcgctattgctgtcaaagccgggcaggccatc
atggaaatttacgccgatcctgcaaatgtcgtgatgactaaggcggatgattcgccgttg
acgcaggccgatttggccgcagataaggtcattaaagcggggctggagaatttgcagttg
ggctggcctgtcttgtctgaagagtctgccgaaataccttatgaaacgcgtaaaaactgg
ccgtgcttctggctggttgatccgctggatggcactaaagaatttatcaagcgtaacggt
gagtttaccgtcaatattgcgctgattgaaaacggcgaaccggtgctgggcgtggtgtat
gcacccgtgttggatgtctgctatttcgcggctcgcggcgtgggggcgttcattaaacgc
ggtgcgcaggcctcgcagccggtcggcgctaaagccgcattgccgggcgaggtgcttaag
atcgtcgccagccgctcgcatgccgacgagcgcactgccgcactacttgtgaagttgggg
gagtacgagtgcatcagcatgggcagttcgctgaaactgtgtctggtcgccgaaggtgcc
gcgcatctgtatccgcgcctcgggcctaccatggagtgggacacagccgcggctcatgcg
gtggttgcctgtgcgggcggccgagtgtgtgattggacgggagcagaattgagctataac
aagccagatttacataacccggaatttctggtcatcgccgaacaagataccaaattactc
gccaaacttattgcgtag

DBGET integrated database retrieval system