KEGG   Gallionella capsiferriformans: Galf_1167Help
Entry
Galf_1167         CDS       T01295                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gca  Gallionella capsiferriformans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:gca00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1261466..1262263
Genome map
AA seq 265 aa AA seqDB search
MFEKLLPQVVAIAVKAGQAIMEIYADPANVVMTKADDSPLTQADLAADKVIKAGLENLQL
GWPVLSEESAEIPYETRKNWPCFWLVDPLDGTKEFIKRNGEFTVNIALIENGEPVLGVVY
APVLDVCYFAARGVGAFIKRGAQASQPVGAKAALPGEVLKIVASRSHADERTAALLVKLG
EYECISMGSSLKLCLVAEGAAHLYPRLGPTMEWDTAAAHAVVACAGGRVCDWTGAELSYN
KPDLHNPEFLVIAEQDTKLLAKLIA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaaattgcttccccaggttgtcgctattgctgtcaaagccgggcaggccatc
atggaaatttacgccgatcctgcaaatgtcgtgatgactaaggcggatgattcgccgttg
acgcaggccgatttggccgcagataaggtcattaaagcggggctggagaatttgcagttg
ggctggcctgtcttgtctgaagagtctgccgaaataccttatgaaacgcgtaaaaactgg
ccgtgcttctggctggttgatccgctggatggcactaaagaatttatcaagcgtaacggt
gagtttaccgtcaatattgcgctgattgaaaacggcgaaccggtgctgggcgtggtgtat
gcacccgtgttggatgtctgctatttcgcggctcgcggcgtgggggcgttcattaaacgc
ggtgcgcaggcctcgcagccggtcggcgctaaagccgcattgccgggcgaggtgcttaag
atcgtcgccagccgctcgcatgccgacgagcgcactgccgcactacttgtgaagttgggg
gagtacgagtgcatcagcatgggcagttcgctgaaactgtgtctggtcgccgaaggtgcc
gcgcatctgtatccgcgcctcgggcctaccatggagtgggacacagccgcggctcatgcg
gtggttgcctgtgcgggcggccgagtgtgtgattggacgggagcagaattgagctataac
aagccagatttacataacccggaatttctggtcatcgccgaacaagataccaaattactc
gccaaacttattgcgtag

DBGET integrated database retrieval system