KEGG   Gallionella capsiferriformans: Galf_1178Help
Entry
Galf_1178         CDS       T01295                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gca  Gallionella capsiferriformans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Galf_1178
DNA repair and recombination proteins [BR:gca03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Galf_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1272277..1272867
Genome map
AA seq 196 aa AA seqDB search
MALSYLDELISALRCLPGVGPKSAQRMAYHLLQRDRKGALHLATSLERAAENVQHCSRCN
NFSELPVCGLCASAARDESLLCVVEMPADQLMIEQTQCFRGMYYVLMGRLSPLDGIGAKE
LQLDNLVRRVQQHPCEVILATNFTVEGDATAHYLATLLQSLGVKVSRIARGLPVGGELEQ
VDSGTLAQAVLERREL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcgctttcgtatctcgatgagctgatttccgcgttgcgctgtctgccgggcgtagga
ccgaaatcggctcagcgcatggcctatcatctgctgcagcgcgaccgcaagggggcgttg
catttggctacctcactggaacgtgccgcggaaaatgtccagcattgctcgcgctgcaat
aatttctccgagttgccggtgtgcggtttgtgtgcctccgccgcgcgcgacgagagtttg
ttgtgcgttgtggagatgccggctgaccagttgatgatagagcagacgcagtgttttcgc
ggcatgtattacgtgctgatgggcaggttgtcgcccctcgatgggatcggcgcgaaggag
ttgcaactggataatctggtcaggcgtgtgcagcaacacccttgtgaagtgatactggcg
accaattttaccgtggagggcgatgcgactgcgcattatttggcaacccttttgcagtcc
ttaggtgttaaagtgtcgcgtattgcgcgtggtttgccggttggcggcgaactggagcag
gtggatagtgggacattggcgcaagccgtgctagaaagacgtgagttatga

DBGET integrated database retrieval system