KEGG   Gallionella capsiferriformans: Galf_1200Help
Entry
Galf_1200         CDS       T01295                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00040  Pentose and glucuronate interconversions
gca00052  Galactose metabolism
gca00500  Starch and sucrose metabolism
gca00520  Amino sugar and nucleotide sugar metabolism
gca01100  Metabolic pathways
gca01130  Biosynthesis of antibiotics
Module
gca_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Galf_1200
   00052 Galactose metabolism
    Galf_1200
   00500 Starch and sucrose metabolism
    Galf_1200
   00520 Amino sugar and nucleotide sugar metabolism
    Galf_1200
Enzymes [BR:gca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Galf_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADL55228
UniProt: D9SFD1
Position
1293225..1294109
Genome map
AA seq 294 aa AA seqDB search
MTRPLKIIRKAVFPVAGMGTRFLPATKASPKEMMAIVDKPLIQYAVEEAVAAGVTDMIFV
TGRSKRSIEDHFDTAYELEAELEKKGKLELLRLTREVIPEGVNCIYIRQSEPLGLGHAVL
CAQPVIKNEPFVVILADDFMVSDVSVTRQMVDVFDRHHSSVLGVQDVPRELTRQYGIVSS
ARVNHELEQVTGIVEKPRPEDAPTTLAVVGRYVLTPRIFHHLHRVGKGTGGEIQLTDGIA
ALIEEERVLAYRYKGTRYDCGSKIGFLQATVAMGLEHPEVKAEFAEYLKNLKVP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaccgttaaaaatcatccgcaaggcggtttttcccgtggcaggtatggggacg
agatttttgccggcgaccaaggccagccccaaggaaatgatggcgattgtggataagcca
ctgattcaatatgccgttgaagaggcggttgccgcgggtgtgacggacatgatatttgtg
accgggcgcagtaagcgttcgatcgaggatcattttgataccgcttatgaattagaagcg
gagctggagaaaaagggcaagctcgaactgctgcgcctgacgcgggaagtgattcccgaa
ggcgttaattgtatttacatccgtcagtcagagcctctggggttggggcacgccgtgctc
tgcgcgcaaccggtcatcaagaacgagccgtttgtggtgattctggcggacgactttatg
gtcagcgatgtctccgtaacgcgtcaaatggtcgatgtgtttgatcgccaccacagctcg
gtactgggtgtgcaggatgtgccgcgtgaattgacgcgccagtacggtattgtcagcagc
gcacgtgtgaatcatgaactcgaacaagtgacagggatcgtcgaaaaaccgcgccctgag
gatgcgccgacgaccttggcggtggtggggcgctatgtgctcacgccgcgtatttttcat
cacttgcacagagttggcaaaggaacggggggcgaaattcagctgaccgatggtatcgcc
gcgctaatagaggaggaacgtgttctggcctaccgttataagggtacgcgttacgattgt
ggctcgaaaattggatttttgcaggcgactgtcgcgatgggactcgaacatccggaagta
aaagcagaatttgccgagtatctgaaaaatctgaaagtaccctga

DBGET integrated database retrieval system