KEGG   Gallionella capsiferriformans: Galf_1238Help
Entry
Galf_1238         CDS       T01295                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gca  Gallionella capsiferriformans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Galf_1238
   01230 Biosynthesis of amino acids
    Galf_1238
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_1238
   00030 Pentose phosphate pathway
    Galf_1238
   00051 Fructose and mannose metabolism
    Galf_1238
   00052 Galactose metabolism
    Galf_1238
  Energy metabolism
   00680 Methane metabolism
    Galf_1238
Enzymes [BR:gca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Galf_1238
Protein phosphatases and associated proteins [BR:gca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Galf_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1339589..1340776
Genome map
AA seq 395 aa AA seqDB search
MAKQLIGKMVIGQSGGPTAVINQSLVGAILAARKHACITGILGAHHGIAGIMKEDFIDLT
TQSVEQLELVAATPAAALGSVRLKPGRAECEKVFEVFKKHDVRYFFYVGGNDSAETAHII
AEMAKEANYDFCTVHIPKTIDNDLKVTDHCPGFASAARFVALAFMGDDRDNNALPGIKVN
VVMGRSAGFLTAAAALARQSETDGPHLIYLPERVFNVASFQQDVRDAVAKYGRCVIAVSE
GITDKDGNPISTSGERDSHGNIQLSGSGALGDTLAALVKAAFPGEKVRVRADTFGYLQRS
FPTIISPIDAKEARQVGDFAVNHAATTGAPGSVSIRRLSSVPYQSECFITPLSSVAREAT
EMKDEYINAAGNDVTQAWLDYVAPLVGELPKIGRL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaagcaacttatcggcaagatggttatcggtcaatcaggcggtcctacggcagtg
atcaatcagtcactggtaggcgcgattctggcggcacgaaaacatgcttgtattaccggt
attctcggtgcgcaccatggcatcgccggtatcatgaaggaagattttatcgatctgacc
acgcaaagcgttgagcaattagagttggttgcggcaacgcctgcggctgcattgggttcg
gtgcgcttgaaacccggtcgtgccgaatgcgaaaaggtctttgaagtgttcaaaaaacat
gacgtgcgttactttttctatgtgggcggcaatgattcggctgagacagcccatatcatc
gccgagatggcaaaagaggcgaattacgatttttgtaccgtgcatatccccaagactatc
gataacgatctgaaagtcaccgatcactgtccgggatttgcgtcagctgcgcgctttgtt
gcgctggccttcatgggtgacgatcgtgacaacaatgccttgcccggtatcaaggttaac
gtggtgatggggcgtagcgccggattcttgaccgccgccgccgcgctcgcgcgccagtct
gaaaccgatggcccgcatctgatctatctgccggaacgcgtgtttaatgtggcatccttc
cagcaggacgtgcgcgatgcggtggctaaatatggccgttgcgtgattgcggtgtccgaa
gggatcaccgataaggatggcaatccgatttcaacgagcggcgaacgcgattcacatggc
aatatccagctctccggcagcggtgcactgggcgatacgctggcagccctggtaaaagcc
gctttcccgggcgaaaaagtgcgcgtacgtgccgataccttcgggtatttacagcgttct
ttcccgacgattatttcaccgattgatgctaaggaggcgcgtcaggtcggcgatttcgcg
gtgaaccatgcggcgacaacgggggctccaggttccgtgtcgatacgccgtttgtcgagc
gtgccgtatcagagcgaatgctttattacgccgctgtcctctgttgcgcgtgaagcgacc
gaaatgaaggatgagtacatcaacgctgcgggcaacgacgtgacgcaggcgtggctcgac
tatgtcgcgccgctggtgggtgagttgccgaaaatcggccgtctgtaa

DBGET integrated database retrieval system