KEGG   Gallionella capsiferriformans: Galf_1325Help
Entry
Galf_1325         CDS       T01295                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00010  Glycolysis / Gluconeogenesis
gca00052  Galactose metabolism
gca00500  Starch and sucrose metabolism
gca00520  Amino sugar and nucleotide sugar metabolism
gca00521  Streptomycin biosynthesis
gca01100  Metabolic pathways
gca01110  Biosynthesis of secondary metabolites
gca01120  Microbial metabolism in diverse environments
gca01130  Biosynthesis of antibiotics
gca01200  Carbon metabolism
Module
gca_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_1325
   00052 Galactose metabolism
    Galf_1325
   00500 Starch and sucrose metabolism
    Galf_1325
   00520 Amino sugar and nucleotide sugar metabolism
    Galf_1325
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Galf_1325
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Galf_1325
Enzymes [BR:gca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Galf_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADL55351
UniProt: D9SFQ4
Position
1446489..1447463
Genome map
AA seq 324 aa AA seqDB search
MIKVLSGDIGGTKTRLAIASVTGTRVEIEHEASFPSQSYDTFDALLGEFLTGLDVPEFSA
FGVAGPVQGRVVQTTNLPWFIDADALQRRFGLTHCALLNDLEATACGLPALGDEDLLTLQ
AGSPDAAGNRAVIAAGTGLGEAGLFWNGKLHQPFATEGGHTSFAPSNTLEFALLRTLQQQ
YQHVSWERVVSGMGIVDLHAFLRQYRSIAAPDWLQVEMAAGDAAAAISNAALRDEICAET
MQLFVRLYGAEAGNLALKIMSRGGLYIGGGIAPKILPLLQSGEFMEALLNKGRMRPLLEA
MPVKVILNDRAALYGPALRAAAKK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagtattgagcggggatatcggcggcaccaagacgcgactggcgattgcgagc
gtaacgggcacgcgggtagagatcgagcatgaagcgagtttccccagtcagtcgtacgac
acgttcgacgcgctgctgggcgaattcttaaccggtttagacgtgccggagttttcggcc
ttcggtgtcgcaggccccgttcagggacgggttgtgcagacgacgaatctgccctggttt
atcgatgctgacgcactgcaacgccgttttggcttgacgcactgcgccttgctcaacgat
cttgaggcgactgcctgcggcttgccagccttaggcgatgaggacttgctgaccttgcag
gccggatcgccggatgctgcgggcaacagggcggtgatcgcggcggggacgggcttaggg
gaggcgggtttattctggaatggcaaactgcatcagccgttcgccaccgaaggcgggcac
acgagtttcgcgccttcgaacacgctggaatttgcgctgctgcggactttgcagcagcag
tatcagcacgtcagctgggagcgcgtggtatcggggatggggatagtcgatctgcatgcg
tttttgcgccagtatcggagtatcgcagcacctgactggttgcaggtcgagatggcggca
ggagatgcggcggccgcaatttcaaatgcggccttgcgtgatgaaatttgtgccgagacc
atgcaattgtttgtgcgtctgtacggcgctgaagccggtaatctggcgctcaaaatcatg
agtcgcggcgggctctatatcggcggcggcatcgcacccaaaatattgccgttgctgcaa
agcggtgaatttatggaagccttgttgaataaaggccgcatgcgcccgttgctggaggcc
atgccggtaaaagtaatactcaatgacagggctgcgttatacggacctgctttacgcgcc
gcagcgaaaaaataa

DBGET integrated database retrieval system