KEGG   Gallionella capsiferriformans: Galf_1338Help
Entry
Galf_1338         CDS       T01295                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gca  Gallionella capsiferriformans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Galf_1338
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Galf_1338
  Amino acid metabolism
   00310 Lysine degradation
    Galf_1338
Enzymes [BR:gca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Galf_1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1463926..1465071
Genome map
AA seq 381 aa AA seqDB search
MSIIEVKVPQLSESVSEATLLTWHKKVGDAVLEGENLIDVETDKVVMELPASKSGVLKKI
IKADGDKVGSEELIALIDTTAVATAAPAAAKIDAPVPPSVRKLAHELDIDAASLEGSGRA
GRVTKEDVLSAATPKAAPILPSAAAPAGGRPEQRVPMTRIRQRIAERLVQSQQTAAILTT
FNEVNMQPVIDLRTKYKDAFEKKHGVKLGFSSFFAKAAVYALQKFPIVNASVDGTDIIYH
GYFDIGIAIGSERGLTVPILRDVDKLSFADIEKQIVDFGARAKTGKLTMEELTGGTFSIS
NGGTFGSMLSTPIINPPQAAILGIHATKDRAVVENGQIVIRPINYLAVSYDHRIIDGREA
VQFLVAIKEALESPERMLLDL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcattgaagttaaagtaccgcaattatccgaatccgtttcagaagcaacgctg
ctgacctggcacaaaaaggtgggcgatgcggtgctcgaaggtgaaaatctgatcgacgtt
gaaaccgacaaagtggtgatggaactgcctgcttctaagagcggcgtgctgaaaaaaatc
ataaaggcggacggcgataaggtcggcagtgaagagctgattgcgctgatcgacacgacg
gcggtcgcaacggctgcgcccgccgctgcaaaaatcgatgcacccgtaccgccttcggta
cgcaaactggcgcatgagctcgacatcgatgcggccagcttagagggcagcgggcgcgca
ggtcgcgtgaccaaagaggatgtgctgagtgctgcaacaccgaaagcagcccccatttta
ccgtcagccgcagctccagccggcggccgtcccgagcagcgcgtcccgatgacgcgtatt
cgtcagcgcatcgccgagcgtctggtgcaatcgcaacagacggccgccatcctcaccacc
tttaatgaggtgaatatgcagccggtgatcgatctgcgtacgaaatacaaagatgcgttc
gaaaagaaacacggtgtaaagctcgggttctcgagcttcttcgctaaggcggccgtgtat
gcgctgcaaaagttccctatcgtcaatgcgtcggtggatggcaccgacatcatctatcac
ggctatttcgacatcggcatcgcgatcggcagcgagcgcggactcacggtgcctattctg
cgcgatgtggacaaactgagttttgccgatatcgaaaagcaaattgtggatttcggcgca
agggctaaaacgggtaagctcacgatggaagagttgaccggcggcacgttctccatttcc
aacggcggcaccttcggttccatgctgtccacaccgatcatcaatccaccgcaggcagcg
atcttggggatacacgcgaccaaagaccgtgccgtggtcgaaaacggtcagatcgtgatc
cgcccgatcaactatctggccgtgtcctacgatcatcgcatcatcgatggtcgtgaggcg
gtgcagtttctggtcgccatcaaggaagcgctcgaatcccctgaacgcatgctgctggat
ctgtaa

DBGET integrated database retrieval system