KEGG   Gallionella capsiferriformans: Galf_1572Help
Entry
Galf_1572         CDS       T01295                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gca  Gallionella capsiferriformans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Galf_1572
   01230 Biosynthesis of amino acids
    Galf_1572
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_1572
   00030 Pentose phosphate pathway
    Galf_1572
   00051 Fructose and mannose metabolism
    Galf_1572
   00052 Galactose metabolism
    Galf_1572
  Energy metabolism
   00680 Methane metabolism
    Galf_1572
Enzymes [BR:gca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Galf_1572
Protein phosphatases and associated proteins [BR:gca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Galf_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1714513..1715661)
Genome map
AA seq 382 aa AA seqDB search
MATQHQLRVQVVAKYIGILTAGGDSPGLNAAIRGVGKAALNHYGMQMIGFRDGFRGLMEN
RTMRLEAADLSDILTRGGTLLGTSRDKPHRMPIGGKQMDMTDVIVGNYYDNHLDVLVCLG
GGGTQKNALRLKERGLNVITLPKTIDNDIAMTDITFGFDTALGIATDAIDRLHSTAHSHH
RIIVVEIMGHRAGWLALGAGIAGGADVILIPEVPYAVESVAEAIRERSRRGKSFSIVAIA
EGALSLQEHATLAEVVKKRNASKHKEGKKAVVESAPELQYAEKTVRLAKQLELLTGLESR
ITILGHLQRGGIPSAADRLLSTRLGTACADLIDQGQFGVMVAARGDATQAVLLEEVAGKV
KTVPQDHPWIQSARHLGISMGD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcaacatcaattaagagtgcaagtcgtggcaaaatatattggaattttaacg
gctggtggcgacagtcccggtctgaacgccgcaatccgcggtgttggcaaggccgcgctt
aatcattacggtatgcaaatgattggttttcgcgatggctttcgcggactgatggaaaac
cgcacaatgcggctcgaagctgctgatctgtctgatattctgacacggggtggtacgttg
ctcggcaccagtcgtgataagccccaccgcatgccaatcggtggaaaacagatggatatg
accgatgtgatcgttggaaattactacgacaaccatctggatgtgctggtttgtctgggc
ggtggcggcacacagaaaaatgccttgcgtctgaaagagcgcggtctgaacgtgattacc
ctgcccaagaccatagacaacgatatcgcgatgaccgatatcacctttggttttgacacg
gccttgggtattgccaccgatgcgattgatcgcctgcacagtacggcgcacagccatcac
cgcatcatcgtggtggaaatcatggggcatcgtgccggctggctcgcgctgggtgccggt
attgccggcggtgctgatgtgatcctgattccggaagtcccttatgctgtggaaagcgtg
gccgaagcgattcgtgagcgcagccgtcggggaaaaagctttagtatcgtcgcgattgct
gaaggtgcgctgtctttgcaggaacatgcgacgctggcagaggttgtgaaaaagagaaat
gccagcaaacataaagagggcaaaaaagccgtcgtcgagtctgcgccagaactgcagtac
gcggagaaaacggtgcgtctggccaagcaactcgaattactgaccggactcgagtcaagg
attaccatcctggggcacttgcagcgtggcggtattccttctgctgcagatcggttgttg
tcgacgcgactcggaactgcctgtgccgatctgattgatcagggacaattcggcgtgatg
gtggcggcaaggggcgatgcgacgcaagctgtgctgctggaggaggtggccggaaaagtt
aaaacagtgccgcaagatcacccctggatacagagcgcccgtcatttaggtatcagcatg
ggagattga

DBGET integrated database retrieval system