KEGG   Gallionella capsiferriformans: Galf_1729Help
Entry
Galf_1729         CDS       T01295                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gca  Gallionella capsiferriformans
Pathway
gca00300  Lysine biosynthesis
gca01100  Metabolic pathways
gca01120  Microbial metabolism in diverse environments
gca01230  Biosynthesis of amino acids
Module
gca_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Galf_1729
Enzymes [BR:gca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Galf_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADL55740
UniProt: D9SGU3
Position
1887409..1888539
Genome map
AA seq 376 aa AA seqDB search
MTETLALAKALIARRSLTPDDAGCQEILIERLEKLGFTIERMRFGNVDNFWARRGINAPV
VVFAGHTDVVPSGPVESWFSPPFEPTIRDEMLFGRGAADMKTSIAAFITAIEAFVEDHPQ
HDGSIALLITSDEEGVAVDGTVRVVEALQARGETLDYCIVGEPTSNKLVGDMIKNGRRGS
LNGTLVVQGVQGHIAYPHLVKNPIHMVSPAIAELATTVWDEGNEYFPPTSWQISNMNGGT
GATNVVPGTVDILFNFRFSTASTELELKNRVHAILDKHGVKYDLLWELSGKPYITPKGNL
VEAISRAIEQSYGITPELSTSGGTSDGRFIADICAQVIEFGPLNATIHKLNECVAVADIE
PLKLTYQRTLENLLCK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacactcgcactcgcgaaggcgctgatcgcgcgccgctcacttacccctgac
gatgcaggctgccaggaaattctgatcgaacgactggaaaagctaggctttaccattgaa
cgcatgcgttttggcaatgtcgataatttctgggcgaggcgcggcatcaatgcgcccgtc
gtggtattcgcaggccacaccgatgtcgtccccagcggcccggtagaatcctggttcagc
ccgccctttgaaccgacgatcagggatgaaatgctgtttggtcgcggtgcggccgacatg
aagacctcgattgccgcattcatcacggcgatcgaagcctttgtcgaagatcacccccag
cacgacggctctatcgccctgttgatcacctccgacgaagaaggtgtagcggtggatggc
acagtgcgcgtagtcgaagccttgcaggcgcgcggcgaaacactggactattgcatcgtc
ggtgaaccgacctccaacaaactggttggcgacatgatcaaaaacggtcgtcgcggctcg
ctcaacggcacgctggtggtgcaaggcgtgcagggtcatatcgcttatccgcatttggtg
aaaaatccgatccacatggtctcccccgccattgccgaactggctacaacagtctgggat
gaaggcaacgaatatttccctcctacttcatggcagatttccaacatgaacggcggcacc
ggcgcgaccaatgtcgtcccgggcacggtcgacatcctgttcaatttccgtttctccacc
gccagtaccgaactggagctcaaaaatcgcgtgcatgcgatcctcgataagcacggcgtc
aaatacgacctgctgtgggagttgtccggcaagccctacattacgcccaagggaaatctg
gttgaggccatcagccgtgcgatcgagcaaagctacggcatcacgcctgaactctcgacc
tccggcggcacctcggacggacgctttattgccgacatctgcgcgcaggtgatcgaattc
ggcccgctgaatgcgaccatccataaactcaacgaatgcgtcgcagtcgccgacatcgaa
cccctcaagctgacctatcagcgcacactggaaaacctgttatgcaaataa

DBGET integrated database retrieval system