KEGG   Gallionella capsiferriformans: Galf_1819Help
Entry
Galf_1819         CDS       T01295                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gca  Gallionella capsiferriformans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Galf_1819
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Galf_1819
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Galf_1819
Enzymes [BR:gca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Galf_1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1984618..1986066)
Genome map
AA seq 482 aa AA seqDB search
MKYISTRGQSPAKTFTEILLAGLAPDGGLYLPEEYPQVTRAELDAWRTLSYADLAYAVLS
KFATDIPAADLQAIVARTYTADIYNNGRADSDFSQITPLRTLVPGVHILELSNGPTLAFK
DMAMQLLGNLFEYALDKQHQELNILGATSGDTGSAAEYAMRGKRGIRVFMLSPNGKMSAF
QRAQMYSLQDENIHNIAINGMFDDAQDMVKAVSNDHAYKAAHKIGTVNSINWGRVSAQIV
YYFKGYFAATQSNDEQVAFSVPSGNFGNICAGHIARMMGLPIGQLILATNENDVLDEFFR
TGAYRPRGTDHTYQTSSPSMDISKASNFERFVYDLVGRDGEKVREFWSRVDAASSTDTAA
FDIKGSDCWHELAKFKFSSGKSTHLDRLKTIRELWEEYGVMVDPHTADGLKVGLEQRRPG
LPLICLETALPAKFEETIVEALGRKPERPESMMGIEELPQKVEVMDADVMQLKAFISAHI
PN
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatctccacacgcgggcagtcgcctgccaagacgtttaccgaaatcctgctg
gcaggcctggcgcccgatggcggattgtatctgcctgaggaatatccgcaggtcacgcgc
gctgagctcgatgcatggcgcacgctgtcctatgcggatctggcgtatgcggtgctgtcc
aagtttgccactgacattccggcagcggatttgcaggcgatcgtcgcacgaacctatacg
gctgacatctataacaacggtcgtgcagattctgacttttcccagattaccccgttgcgc
accctggtgccgggcgtgcatatactcgaattgtccaacgggccgacgctggcgttcaag
gacatggcgatgcagctgctgggcaacctgttcgaatacgcgctggacaagcagcatcag
gagctgaatattctcggcgcgacctcgggcgacaccggatcggctgccgaatacgcgatg
cggggaaaacgcggcatccgtgtgtttatgctctcgccgaacgggaaaatgtcggccttc
cagcgcgcgcagatgtattcgctgcaggatgagaatatccacaatatcgcgatcaacggc
atgttcgacgacgcgcaggatatggtcaaagccgtgtccaatgatcacgcttacaaggcc
gctcacaagattggcaccgtcaattcgatcaactgggggcgtgtgtcggcgcagatcgtg
tattactttaagggctatttcgcggcgacccaatcgaacgacgagcaagttgcgttttcc
gtgccgtcgggcaatttcggcaatatctgtgcaggtcacatcgcgcgcatgatgggattg
ccgatcggtcagctgattctggccaccaacgaaaacgatgtattggacgaatttttccgc
acgggggcttatcgtccgcgcggcacagatcacacctatcagaccagcagcccgtcgatg
gatatttccaaagcgtccaatttcgagcgtttcgtgtacgatctggtcggacgcgatggc
gagaaggtgcgggaattctggagccgagtggatgctgccagttcaacagataccgctgcg
ttcgacatcaagggaagtgactgctggcacgagctggcaaagtttaaattctcgtcggga
aaaagcactcatctggatcgcctcaaaacgatccgtgagttgtgggaagagtacggcgtg
atggtggatccgcataccgcagatgggctgaaggtcggccttgagcagcgccgtcccggt
ctgccgctgatctgtctggaaacagcactgcccgccaagttcgaagaaaccatcgtcgag
gcattggggcgcaaacctgaacgtccggagtcgatgatgggaatcgaagaactgccgcaa
aaagtcgaggtgatggatgcggatgtgatgcagctcaaggcattcatttctgcgcacatc
cctaattga

DBGET integrated database retrieval system