KEGG   Gallionella capsiferriformans: Galf_2146Help
Entry
Galf_2146         CDS       T01295                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gca  Gallionella capsiferriformans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Galf_2146
   01230 Biosynthesis of amino acids
    Galf_2146
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_2146
   00051 Fructose and mannose metabolism
    Galf_2146
   00562 Inositol phosphate metabolism
    Galf_2146
Enzymes [BR:gca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Galf_2146
Exosome [BR:gca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Galf_2146
  Exosomal proteins of bladder cancer cells
   Galf_2146
  Exosomal proteins of melanoma cells
   Galf_2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2325847..2326599)
Genome map
AA seq 250 aa AA seqDB search
MRRKLVVGNWKMYGRLARNQALLQGVLDGVRELRAADYAVCVPYPYLSQAATMLAGSNVA
WGAQNLSPQEEGAFTGAVAPGMLVDFGCSYVIIGHSERRGLFHESNEIAAAKFEAAQKAG
MKPIFCVGETLAERESGITEQVVATQLDAVLVRFGAKALSNAVIAYEPVWAIGTGKTASP
DQAQAVHAFIRQRVAAHDAAVAQGLCILYGGSVKASNAVELFGMPDIDGGLIGGASLVAD
DFVAICRAAQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcaaactagtcgttggaaactggaaaatgtacggccgcttggcgcgtaatcaa
gcattgctgcaaggggttctggacggcgttcgtgaattgcgcgctgcagactatgcggta
tgtgttccgtatccctatctgtctcaggcggcaacgatgttggcaggtagtaatgtggct
tggggggcgcagaatttgagtccacaggaagaaggcgcgttcacgggtgcggtagcgccc
ggcatgctggttgattttggttgcagttatgtgattatcggtcactccgaacgtcgcggt
ctgttccatgaaagcaatgaaatcgctgctgcgaagtttgaggcagctcaaaaggccggt
atgaagccgatcttctgtgtgggcgaaacgctagctgaacgtgagtccggaattacagaa
caagtcgttgcaacgcaactggatgccgtgctggtgcgttttggcgcgaaggcactgtcc
aatgcggtgattgcatacgaacctgtgtgggcaatcggtaccggcaagacggcaagtcca
gatcaggcgcaggcagtgcacgcgttcattcgtcaacgtgtagcggcgcatgatgcagcg
gttgcgcaaggtttatgtattctttacggcggcagtgtgaaggcatccaatgcggtcgaa
ttgttcggtatgccggacatcgatggcggtctgattggtggcgcttcgctggttgctgat
gattttgtggcgatatgtcgcgcagcgcaataa

DBGET integrated database retrieval system