KEGG   Gallionella capsiferriformans: Galf_2429Help
Entry
Galf_2429         CDS       T01295                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gca  Gallionella capsiferriformans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gca00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2618689..2619843)
Genome map
AA seq 384 aa AA seqDB search
MSATIAKIVIGVLAWLMVALSADAQTCWPAWQAFGSQFIQADGRVLADESEQRYSTSEGQ
AYGLFFALIADDRPRFEKILLWSRDNLAGGDLSAHLPAWQWGKRADGTWGVVDQNSASDA
DTWFAYTLLEAGRLWHEPRYTALGRLMLANIRIQLVRNLPGAGNVLLPAANGFSLDAGGS
RLNPSYIPIQLFRAFSVVEPEGPWVQIIDNNLAMLNRITAMGYAPDWAAYVPGRGYLIDP
LRGAIGTHDAIRIYLWWGMLSRQDPAFGGMKKLIYGMNKLIPKYQITPPLKVDTQTGDVS
GMSPPSFSAALLPYFKTMKNSVAVQLQNDRLISKTENDLLIGEDIRYYDQVLALFGQGWM
ARRFAFSSQGQLVVQWKPSCSAIK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccactatcgctaagatagtgatcggcgtactggcatggctgatggtggccttg
tcagcggatgcgcagacttgttggccggcatggcaggcattcggcagccagtttatacag
gctgacgggcgagttctcgctgatgaaagtgagcagcgttacagtacttctgaaggccag
gcgtatggcttgttttttgcactgatcgccgatgaccggcctcgttttgaaaagatcctg
ctgtggtcgcgcgataatctggcaggcggagacttaagcgcacatctgcctgcctggcaa
tgggggaaaagagccgatggcacatggggggtggtggatcaaaactccgcctccgatgcg
gacacttggtttgcttataccttgctagaagcggggcgtttatggcatgaaccacgctat
acggcgctgggtcgcttgatgctcgccaatattcgcattcaactggtgcgtaatctgcct
ggtgcaggcaatgtgttattgcccgccgcgaatggattttctcttgatgcaggcggttcg
cgtctgaacccgagttacatcccgatacaattatttcgcgctttttctgttgtcgagcct
gagggaccttgggtgcaaatcatcgacaacaatctagccatgcttaaccgtatcacagcc
atgggctatgcgcctgattgggcggcttatgttcccggtcgcggctacctgatcgatcct
ctgcggggcgcaattggcacgcatgatgcgatacgcatctacttgtggtggggaatgttg
tccaggcaggatcctgcgtttggagggatgaaaaaactgatttacggtatgaacaaactg
ataccgaaatatcagataacgccgccattgaaggtggatacgcaaaccggggacgtgtcg
ggaatgagtccccccagcttttctgccgccttgctaccctattttaagacgatgaaaaat
agtgttgcggtgcaattacagaatgacaggctgatctcaaagacagagaatgatttatta
atcggtgaggacattcgttattatgatcaggtactagctctgtttggtcaaggctggatg
gcgcgccggttcgcattttcctcgcagggtcaactcgttgtacagtggaagccatcatgt
tcagctataaaataa

DBGET integrated database retrieval system