KEGG   Gallionella capsiferriformans: Galf_2451Help
Entry
Galf_2451         CDS       T01295                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gca  Gallionella capsiferriformans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Galf_2451
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Galf_2451
Enzymes [BR:gca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Galf_2451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2647443..2648576
Genome map
AA seq 377 aa AA seqDB search
MSGSTIKTVLTGCRRIVVKVGSSLVTNQGAGLDLKALGNWARQIAALNGKGYEVVLVSSG
AIAEGMQRLGWTSRPVAIHELQAAAAVGQMGLVQAYESCFRHHDLHAAQVLLTHADLADR
ERYLNARATLTTLLSLRVIPIINENDTVVTDEIKFGDNDTLGALVTNLIDADALVILTDQ
SGLFTADPRKDPSATLVASAQAGDASLEAMAGGAGSAIGRGGMLTKILAAKRAAASCAHT
VIASGHEPDVLLHLFEGVAIGTLLTAPALPLAARKQWLAGHLQVTGRLVLDQGAIKALRS
DGKSLLPIGVKQVSGEFGRGSVVACVSEQGTDIARGLVNYNSDEAVRIAGRASQDIATLL
GYGGDAEIIHRDNLVLL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctggatcgacaattaaaacagtattgaccggctgccgtcgcatcgtcgtcaaagtc
ggcagctccctcgtcaccaatcagggcgcaggccttgatctgaaggcgcttggcaactgg
gcacgtcagatcgccgcactgaacggcaaaggctatgaagtcgtgctggtatcctcaggc
gcgatcgcagagggcatgcagcgtctgggctggacgagccgcccggtcgcgatccacgaa
ttacaggcagccgcagccgtcggtcaaatgggactggtgcaagcctatgaatcctgtttt
cggcatcatgacttgcacgcagcacaggtattgttaacgcatgcagatctggcagaccgt
gagcgctatctgaacgcgcgcgccacgctgaccaccctgctctcattgcgcgtcattccc
atcatcaatgaaaacgatacggtggtcaccgatgagattaaattcggcgacaacgacacc
ctgggcgccctagtcaccaacctgatcgacgccgatgccctggtgatactcaccgaccag
agcggtctgtttactgccgatccgcgcaaagacccgagtgccacgttagtcgccagcgca
caggcaggggacgcaagtctggaagcgatggcgggaggagccggcagcgcgatcggtcgc
ggcggcatgctcaccaaaatcctcgccgcaaaacgtgccgccgcaagttgcgcgcacacc
gtgatcgcctcagggcacgaaccggatgtgctgctgcatctattcgagggggtcgccatc
ggcacgctgctcactgcaccggcgctgccgcttgcagcgcgcaaacagtggctggcagga
catctgcaagtcacaggccgtctggtgctggatcaaggcgcgatcaaagcgctacgctcc
gacggcaagagcctgctgcctatcggcgtcaaacaggtatcaggagaattcggacgcggc
tcggtcgtcgcctgcgtcagcgaacagggtacggatattgcgcgtggccttgtcaactac
aactcggatgaagccgtccgtatcgcaggccgcgcgagtcaggacattgcaacattgtta
ggttacggcggggatgccgaaatcatccatagagataatttggtattgctgtaa

DBGET integrated database retrieval system