KEGG   Gallionella capsiferriformans: Galf_2495Help
Entry
Galf_2495         CDS       T01295                                 

Definition
Phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
gca  Gallionella capsiferriformans
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:gca00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:gca00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:gca00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2683236..2684306)
Genome map
AA seq 356 aa AA seqDB search
MKNKSAIVACVLLCSISSAYADAFATCAQTFKNDAVQRLNCFDEALTASTMAHSAATVQL
PSDTVEEVKPVAEPLISKQARSYLTRVWNLDNRMHRNSSALDRLTPHKQSYLVVRDTSRV
NNLPYSPAPAHTVLTPYNMDALETKFQLSFKTDIGTLENIDLWGLKTLRVWGAYTQQSHW
QVFNSRNSSPFRETNYEPELIAAFGTGRESGWKLLNLGIVHQSNGRTNPESRSWNRLYAQ
GGWEWDNFSLLARGWWRIPEKAATDDNPDIVHYLGRGDLVARWEPDSKSQAVALLVRNNF
NLNQNIGFTQLDWSMPVALGHAARLHAQFGTGYGESMLDYNHRQTTLGLGVSFREW
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaatcagcaatcgtggcatgcgtgctgttgtgttcaatctcatcggcgtat
gccgatgcttttgcgacctgcgcgcagacatttaaaaatgacgctgtgcaacgtttgaac
tgtttcgatgaggcgttaacggcttcgacgatggctcactcagctgccactgtgcagctt
ccgtctgacacagtagaggaggtgaagcctgtggccgaaccgctgattagcaagcaggcg
cgctcttatttgacacgggtatggaatctggataatcgtatgcaccgcaattcgagtgcg
ctagatcgtctgacgccgcataaacaaagctatctggttgtgcgtgacaccagcagggta
aataatctgccctactctccagcgccagctcatactgtcttaacgccctacaatatggat
gcgctcgaaaccaagtttcagctcagtttcaaaacggatatcggtacgctggaaaatatc
gatctgtggggattaaaaacgctgcgggtgtggggggcatatacacagcaatcgcactgg
caggtatttaattctcgcaactcatcaccgtttcgtgaaacgaattatgagcctgaattg
attgcggcctttggcacgggcagggaatcgggatggaagctgctcaatttgggaattgtc
catcaatcgaatggacggaccaatcccgaatcgcgcagctggaaccgtttgtatgcgcaa
ggcggttgggagtgggataacttttccctgctggcgcgaggttggtggcgcattcctgag
aaagctgcgacggatgataatcctgatatcgtgcattatctcgggcgcggcgatctggtc
gcgcgctgggagccggacagcaaatcgcaggccgtggcactgctggtacgcaataatttc
aatttgaatcaaaacatcgggtttacccagttggactggtctatgccggttgcattgggt
catgcggcccgtttgcacgcgcaatttggcacgggttacggcgagagcatgctcgattac
aaccaccgtcagacgacattgggtctgggtgtctcattcagggagtggtaa

DBGET integrated database retrieval system