KEGG   Gallionella capsiferriformans: Galf_2664Help
Entry
Galf_2664         CDS       T01295                                 

Definition
Disulfide bond isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gca  Gallionella capsiferriformans
Brite
Enzymes [BR:gca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Galf_2664
Secretion system [BR:gca02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Galf_2664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2870479..2871162
Genome map
AA seq 227 aa AA seqDB search
MNKILSLLLLLACSAANAGEAEIRQSLQGKVGKLEHIAKTPYAGLYEIMIGDKVLYTDEL
GLYLIDGSVIDVKNRTDLTEQRRRQLFNFDKLPLELAVKRVKGNGKRKLAYFTDPQCGYC
KKLEKELSKVSDVTLYMFLYPIFPGSEEIVRNVRCAKDPAKTWDDLMLKGIAAASIACKT
PTDKVMAFGREKQVNGTPNLIFADGTQVPGYLPAEELEKHLNEAAKK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatactatcgctgttattattactcgcctgctctgccgccaacgccggcgaa
gctgaaatccgccagtccctgcaaggaaaagtcggcaaactcgaacacatcgcgaaaacc
ccttacgcagggctatacgaaatcatgatcggcgacaaagtgttgtacaccgacgaactc
ggcctctacctgatcgacggcagcgtcatcgatgtcaagaaccgcaccgatttaacagag
cagcgccgccgtcagctgtttaatttcgacaagctcccgctggaactggccgttaaaaga
gtaaaaggcaacggtaaacgcaaactggcgtattttaccgacccgcaatgcggctactgc
aagaagctggaaaaagagttatccaaagtcagcgacgtcacgctgtatatgttcctgtat
ccgatcttcccgggttcggaagagattgtacgcaatgtgcgctgcgctaaagatcctgcc
aagacctgggacgatttgatgctcaaaggaatcgcggcagcgagcatcgcctgcaaaacg
cccaccgacaaggtcatggcatttggccgcgaaaaacaggtcaacggcacgcccaacctg
atttttgccgacggcacacaagtgccaggttacctgcccgccgaagaactggagaaacat
ttaaacgaggccgctaaaaaatag

DBGET integrated database retrieval system