KEGG   Gallionella capsiferriformans: Galf_2671Help
Entry
Galf_2671         CDS       T01295                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gca  Gallionella capsiferriformans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Galf_2671
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Galf_2671
   00020 Citrate cycle (TCA cycle)
    Galf_2671
   00620 Pyruvate metabolism
    Galf_2671
Enzymes [BR:gca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Galf_2671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2878619..2879866
Genome map
AA seq 415 aa AA seqDB search
MAEIKQVLVPDIGDYKGVSVIEVMVKVGDTINEEDTLLTLETDKAAMDVPSPYSGIVKEL
HVEIGDKVSRGSLILVMESSDAAAPAAAPVAAPVIVAPVAAPVAVVAQTVQSVVSSGKAH
ASPAIRRFARELGADIAQIKGSGEKGRVTKEDVQNFIKAALAQPRGAAGGNGLQVLDMPV
FDFAKFGTIETRPLSRIQKISGANLHRNWVTIPHVTQFDEADITEMEAFRKQLGTEYAKQ
NIKITPLAFMLKAVVAALQKFPKFNASLDGDNLILKQYFHIGVAVDTPDGLMVPVLRDVD
KKGIVQLATELGEISTRARDKKITAADMQGGCFTISSLGGIGGTAFTPIINAPEVAILGV
SRSAMKPVYQDGVFVPRLMLPLSVSYDHRVIDGAAAARFTAYLAQVLSDIRRLAL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaaataaaacaggttttagtgccggatatcggcgactacaagggcgtcagcgtt
atcgaagtcatggtgaaagttggcgacacaatcaacgaagaagataccctgttgacgctg
gaaacagacaaggcggcgatggatgtcccctcaccctactccggcatcgtcaaggagtta
cacgttgaaatcggcgacaaagtgtcgcgcggttcgctgattctggtcatggaaagcagc
gatgctgcggctccagcagctgcaccggttgcagcgccggtaatcgtcgcaccagtcgct
gcaccggtcgccgttgtcgctcaaacagtgcagtccgttgtatcctcgggcaaagcacac
gcaagcccggccatccgccggtttgcccgcgaactgggtgcggacatcgcacaaatcaag
ggcagcggtgaaaagggccgcgtcaccaaagaagatgtgcagaacttcattaaggccgcg
cttgcccaaccgcgcggtgcggcaggcggtaacggcctgcaggtgctggatatgccggta
ttcgattttgcgaaattcggcacgatcgaaacccgtccgctgtcccgtatccagaaaatt
tccggcgcaaatctgcatcgcaactgggtgacgattccgcatgtcacgcaatttgacgag
gcggatatcaccgagatggaagccttccgcaagcaactgggtacagagtacgccaagcaa
aacatcaagatcacgccgctggccttcatgctcaaagcggtggtggcggccttgcagaaa
ttccccaagttcaacgcctcgctggacggcgacaatctgatattgaagcaatatttccat
atcggtgtcgcggtcgatacgccggatggactgatggtgccggtgctgcgcgatgtagac
aaaaagggcatcgtgcaactggccaccgagcttggcgaaatttcgacgcgcgcacgcgac
aagaaaattaccgcagcggatatgcagggcggttgcttcacgatttccagtctgggcggc
atcggtggcacggcgtttacgccgattatcaatgcgcctgaagtcgctattctgggtgta
tcgcgctcggccatgaaacccgtgtatcaggacggtgtatttgtgccgcgtctgatgctg
ccgctgtcggtctcctacgatcatcgcgtgatcgacggggcggccgcagcgcgtttcacc
gcctacctcgcacaggtgctgtccgacattcgccgactggcgctttag

DBGET integrated database retrieval system