KEGG   Gallionella capsiferriformans: Galf_2761Help
Entry
Galf_2761         CDS       T01295                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gca  Gallionella capsiferriformans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Galf_2761
Enzymes [BR:gca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Galf_2761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2965322..2967526
Genome map
AA seq 734 aa AA seqDB search
MSAFGFDQEVTVTKVFSQMEGGAIFTSVTSDGEVVRVKYQGRDVIPLPGDTFHIKGQWKN
YTDKYRRIHHQVDSKIMKRRVVVGDLLGPWLQRIPNIGPERGKRLLDRFGHDLVTVLKDA
TRMAEIAETIEPNKPALAARLAAQIYAAMVSKTAADQVKVAEAEFLAYLEKIGLREPRTA
FRLWRFMAGSNAPEQLLKNPYVPAHLMDWSVADRLGKRLLRESEVSENLDVHPARLMGAL
ASVWRELIGNGDSAASEQCVREMLVDRGVDPDLALAHARCLHHLYESGDLIRAPGAAWIE
NEVARAFERIESYPPTIPVPHDAAIDKIIGDGERATDLRLTDEQRDSLRKLLHNPIGVLQ
GGAGTGKTTVMKVLAYCWERLGGNVVMGALAGKAALQLSRGASTHNCPRLAYTLARLIGM
LEEQAFLNVETRSKRRPDVTFDSMTLLVIDEAGMMDTPTLHRILALLPTGARLLFVGDCG
QLFPIGFGKVFHDLVADGTRVVRLTKILRQANDSVIPHVANQVHCGITPSLQEWRGEAKG
VFTVHVNQRERVQRELHGVDFLVVAALRNTVASINESEAEARQDQHVPTRRLGPLATVAV
GDPIVITVNRYKHGLFNGLLGVVTEISEARVQVRFDGESESRDLPEEAEGDVELAYAITC
HKAQGSSANTVMVLVEATSLATREWLYTAVTRAKQLVLLVIGESGDLERAVARRTVRTTG
FRVGEAKGCQGTVE
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcatttggtttcgatcaggaagtcacggtaactaaggtcttctctcagatggaa
ggcggcgctatcttcacgtccgtcacgtcagatggggaagttgtgcgggtcaagtatcag
gggcgagacgtgatcccgttgccaggcgatacctttcacataaaggggcaatggaaaaat
tatacggataaatatcgccggatccatcatcaggttgatagcaagatcatgaaacggaga
gtggtcgtaggggatctgctcggcccgtggcttcaacgcattccaaacattggaccggag
cgcggtaagcggctcttagatcgctttggccatgatctggtgactgtcctcaaggacgcg
actcgtatggcagaaatcgccgagacgatcgagccgaataaaccggcattggccgctcgc
cttgccgcgcagatatatgcagccatggtcagcaagaccgcagctgaccaagtgaaggtc
gcggaagccgagtttctggcttacttggagaagattgggctgcgcgagccgcgtaccgcg
tttcgcctctggcggttcatggcgggatctaacgccccggaacaattgctcaaaaatccc
tatgtgccagcgcacctcatggattggagtgtcgctgaccgactagggaagcgcctgctc
cgtgagagcgaagtttctgagaatctggatgtacatccagcccgtttgatgggagcacta
gccagcgtttggcgcgaactcattggtaatggtgacagcgcagcaagcgagcaatgcgtt
cgggagatgcttgttgatcgaggtgtcgatccagacctcgcgcttgcgcacgccagatgt
cttcatcacctttacgaatccggcgacctcattcgtgcgccaggtgctgcctggattgaa
aatgaggtggcacgtgcctttgagcggatcgagtcctaccctcctaccattccggtacct
cacgatgctgccatcgataaaatcatcggcgacggcgagcgtgccaccgacctccgactg
acagatgagcagcgcgactcactccgaaagcttctgcacaatccaattggtgtcctgcag
ggcggggccggtacggggaagacaaccgtgatgaaggttctggcatactgctgggagcgt
ttaggcggcaacgtagttatgggggcgctcgctggaaaggcggccctgcagctctctcgt
ggcgcgtcgactcataattgtcctcgtcttgcatacacccttgcccgattgataggcatg
ctcgaagaacaggcgttcctgaatgtagagacgagatcaaaaagacggccagacgtaacc
tttgactccatgacactgctggtcattgatgaagcgggcatgatggacacgcccacactc
catcgaatactggcactattgccaacaggagctcggttgctctttgtaggggattgcggg
cagttgtttcccatagggtttggcaaggtgtttcacgatctcgtagccgatggaactcgc
gttgtcaggcttaccaaaatattgaggcaggccaatgacagtgtgataccacatgtcgca
aaccaggttcactgcgggataacgcctagtctgcaggaatggcgaggagaagccaagggg
gtatttaccgtgcatgtaaaccaacgcgagcgtgtacagagagagctgcatggcgtcgat
ttcttagttgtggcagctctcagaaacactgtagccagtattaatgaatccgaagcagag
gcacggcaggaccagcatgttccaactcgccgccttgggccgctggcgacggttgctgtc
ggcgaccccatagtgattaccgtcaatcggtacaagcatggcctatttaatggcttgttg
ggcgtcgtaacggagatatccgaggcgagggttcaagttcggtttgacggcgagtcagag
tcgcgcgacttgcctgaagaagcggaaggcgacgttgaacttgcctatgcgattacctgc
cacaaggcgcagggatcaagcgccaatacggtaatggtgctcgtggaagccacttcgttg
gccacgcgggagtggttgtatactgctgttacgcgtgcaaagcaattggtgctgttagta
attggtgagagtggtgatttggaacgcgcagtagcgcgaaggactgtgcgaactacagga
tttcgcgttggtgaagcgaagggctgtcaaggcaccgtggaataa

DBGET integrated database retrieval system