KEGG   Gallionella capsiferriformans: Galf_2859Help
Entry
Galf_2859         CDS       T01295                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gca  Gallionella capsiferriformans
Brite
Enzymes [BR:gca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Galf_2859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3071899..3072546)
Genome map
AA seq 215 aa AA seqDB search
MQNLEQARFNMIEQQIRPCDVLEARILELLHHVRREQFVPDGKKAMAFMDMEIPLGYGVS
MWQPKLEARALQELHIGRSDKVLEVGTGSGYLTALLSAFAGHVTSVEIVPELSEIARTHL
LHRENVTLAVGDASHGWGSEKYDVIVLTGSTPVLPLVFQSSLNVGGRLFAIVGDAPVMEA
RLITRVAADVFETVNIMETSVAALQNAQQPKRFVF
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatctggaacaggcacgcttcaatatgattgaacagcaaattcgcccgtgtgat
gtgttggaagcgcggattctcgagttgctccatcacgtcaggcgtgaacagttcgtgcct
gacggtaaaaaagcgatggcctttatggatatggaaattccgttaggctacggcgtctcg
atgtggcagcctaaactcgaagcgcgtgcgttgcaggagttacatatcgggcgctcggat
aaagtgctggaagtcggtaccggcagcggctatctgacggcgttgctgtccgcatttgca
ggtcacgtcacctcggtcgaaatcgtgcctgaattgagtgaaattgcgcgcacccatttg
ctgcaccgtgaaaatgtgacgctggcggtcggcgacgcatcgcatggctggggcagcgaa
aaatatgacgtcatcgtattgacgggttcgacgccggtgttgccgctggtgtttcaaagt
agtctgaatgtcggcggacgcctgtttgccatcgtcggcgatgccccggtcatggaagcc
cggctgatcacgcgcgttgcggccgatgtttttgaaacggtcaacatcatggaaacgtcc
gttgccgcgctgcaaaatgcgcaacagcctaaacggtttgtattttaa

DBGET integrated database retrieval system