KEGG   Geobacillus sp. C56-T3: GC56T3_0018Help
Entry
GC56T3_0018       CDS       T01245                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gct  Geobacillus sp. C56-T3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gct00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GC56T3_0018
DNA repair and recombination proteins [BR:gct03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GC56T3_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
28343..28939
Genome map
AA seq 198 aa AA seqDB search
MHYPEPLSKLIDSFMKLPGIGPKTAARLAFHVLAMKEDTVLEFAKALVDVKRHIHYCTIC
GHITDTDPCYICKDERRDRTTICVVQDPKDVIAMERMKEYNGLYHVLHGAISPMEGIGPE
DIKIAELLTRLQDETVQEVILATDPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccgctatcgaagttgattgacagttttatgaaactgcccggcatc
ggcccgaaaacggctgcccgccttgcatttcatgtgctggcgatgaaagaagacaccgtg
cttgagtttgccaaagcgctcgttgatgtcaagcggcatattcattattgcacgatttgc
ggacatattacagatacagacccttgctacatctgcaaagacgagcggcgcgaccggacg
acgatttgcgttgttcaggatccgaaagatgtcatcgccatggagaggatgaaagaatac
aatggcctgtaccacgtgttgcacggggccatctcgccgatggaaggcatcggaccggaa
gatattaaaatcgccgagctgctcacgcgattgcaggatgagacggtccaagaggtgatt
ttagcgacagacccgaacatcgagggagaggcaacggcgatgtacatctcccgcctgttg
aagccgacaggaatcaaagtcacccgcatcgcccatggcttgccggtcggcggcgacttg
gagtatgcggacgaagtgacgttatcaaaggcgttggaagggcgccgtgagctatag

DBGET integrated database retrieval system