KEGG   Geobacillus sp. C56-T3: GC56T3_0662Help
Entry
GC56T3_0662       CDS       T01245                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gct01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:gct00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
709589..711004
Genome map
AA seq 471 aa AA seqDB search
MALNIDWMNEAKKRKDDLVRDVQALVRIPSVRDDQQAQPGAPFGPKVAEALEHMLRRGRE
EGFRVKNVDGFAGHIEMGHGEKLVGVLGHIDVVPPGDGWTMDPFAAEVRDGRLYGRGAID
DKGPTVAAFYAMKIIRDLGLPLGKRVRLIIGGDEESDWRCVEHYFRHEEMPDVGFAPDAD
FPIIHAEKGIIDADLAYRPLESAEAEGLALASFRAGRRYNMVPDAAEAVVEGAGRTEELL
GLYEQFCRERGVKGSIRQSEGAVVFQLEGVSAHGAEPERGKNAGVYLAQFLASLPLDGRS
RPFIQFVASAFFGDARGRRLGLAYRDEQSGDLTVNVGVLSYDRQHGGTIGLNIRYPVTAD
GEAIRRTLAGAAAEHGFALSRFSDTKPHYIDPSHELVRTLQRVYEEQTGEPAQLLAIGGG
TYARALTAGVAFGALFPGRPDVAHQKDEYIEIDDLVKATAIYAQAIYELAK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaacatcgactggatgaacgaagcgaagaaacgaaaagacgatcttgtccgc
gacgtgcaagcgcttgtccgcattccgagcgtccgcgatgatcagcaggcgcagccgggc
gcgccgtttgggcccaaggtggccgaggcgcttgagcatatgcttcgccgcggccgggag
gaagggtttcgcgtcaaaaatgtggacgggtttgccgggcatatcgaaatggggcatggg
gagaaacttgtcggcgtgctcggccatatcgacgtcgtgccgcctggggacggctggacg
atggatccgtttgccgctgaggtgcgcgatggccgcctttacgggcgcggcgcgatcgat
gacaaagggccgaccgtcgcggcgttttacgcgatgaaaatcatccgtgacctcgggctg
ccgcttggcaagcgggtgcggcttatcatcgggggcgatgaggaaagcgactggcggtgt
gtggagcactattttcgtcatgaagaaatgccggatgtcggatttgcgccggatgctgat
tttccgatcattcatgccgaaaaaggaatcattgacgccgatttggcataccgcccgctt
gaatcggcggaggcggaagggctcgcgcttgcctcatttcgagctgggcgccgctacaat
atggtgccggatgcggccgaagcggtggtggaaggagcgggacggacggaggagctgctt
ggcctctatgaacagttttgccgggagcgcggcgtaaaggggagcatcaggcaaagcgaa
ggggccgtcgtctttcaattggaaggggtgtccgctcatggcgctgagccggagcgcggc
aaaaacgccggcgtctatttggcgcagtttttggcgtcgcttccgctcgatggccgaagc
cggccgttcattcagtttgtggcctccgcctttttcggcgatgcccgcggccggcggctt
ggccttgcgtatcgcgacgaacaaagcggcgacttgaccgtcaacgtcggggtgctgtcg
tatgaccggcagcatggcggaacgattgggctgaacatccgctatccggtgacggccgac
ggcgaggcgatccgccggacgctcgctggcgccgcggctgaacatggattcgcgctcagc
cggttcagcgatacgaagccgcattatatcgacccgagccacgagcttgtccgcacgctt
cagcgcgtctacgaagagcagacgggcgagccggcccagcttttggccatcggcggcggc
acatacgcccgcgccttgaccgccggggtggcgtttggcgcgttgtttccgggccgtccg
gatgtcgcccaccagaaagatgagtatatcgaaatcgacgatttggtgaaagcgaccgcc
atttacgcgcaggcgatttacgagctggcgaaataa

DBGET integrated database retrieval system