KEGG   Geobacillus sp. C56-T3: GC56T3_0733Help
Entry
GC56T3_0733       CDS       T01245                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00010  Glycolysis / Gluconeogenesis
gct00620  Pyruvate metabolism
gct00640  Propanoate metabolism
gct00680  Methane metabolism
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
gct01130  Biosynthesis of antibiotics
gct01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GC56T3_0733
   00620 Pyruvate metabolism
    GC56T3_0733
   00640 Propanoate metabolism
    GC56T3_0733
  Energy metabolism
   00680 Methane metabolism
    GC56T3_0733
Enzymes [BR:gct01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GC56T3_0733
Lipid biosynthesis proteins [BR:gct01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GC56T3_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADI25778
JGI: GC56T3_0733
Position
complement(784945..786603)
Genome map
AA seq 552 aa AA seqDB search
MANNRSPASLIQSFSWDQAFAHYDWDPRSRFNAAHEVCDRYAEDPNRIALFYENALGEQK
TITYRQLRDWSNQMANVFRKLGVKKGDRVCALMPKNPALVVYILAAWKVGAVYVPLFTAF
GPQAIEYRINHSEAKVLLTNKEQRAKLPPQDNMPTLEHIFVIDGPSHDQDQPFWETLSKE
STEHSIEETTVDDLLAIQYTSGSTGMPKGAMWPHNVLINIYPYMRYAIGLRDDDVFFGGA
DPGWAYGLIFCTFAPMAFGVPIVFYEGPFKPETCYSLMEKYRVTNFAYAPTAYRAMAAAG
ADVIRRYQLNVRAMSSAGEPLNPEVIRFFQEHVGVTIHDHYGLSETLMLIGNFNAAEMEI
RPGSMGWPLPGFDVALLNENGNPVADGEVGQIAFNTDSIPNVFKGYWKDPEKTAERLVGK
WFLTGDLATKDEDGYFWFQGRADDIISSAGYRIGPFEIESCLLEHPAVVEAAAVGKPDPV
KGEIVKAFVVLREGFAPSDELADELSLFVKTRLSKHEYPREVEFVAELPKTPSGKIQRFI
LRNQEREKQKKA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggccaacaatcgatcacctgcctcactcattcaatcattttcttgggatcaggcattc
gctcattacgactgggatccccgcagccggttcaacgccgcccatgaagtatgcgaccgg
tatgccgaggatccgaaccgcattgcgctattttatgaaaacgctttaggagagcaaaaa
acgatcacctatcggcaattgcgcgattggtccaaccaaatggcgaacgtgttccgcaag
ctgggcgtgaaaaaaggggatcgcgtctgcgcgctgatgccgaaaaacccggcccttgtc
gtctacattttggcggcttggaaagtcggcgccgtgtatgtgccgctctttaccgcgttt
ggcccacaggcgattgaatatcgcatcaaccattccgaggcgaaagtcctcttgacgaac
aaggaacagcgcgccaaactgccgccgcaggacaacatgccgacattggaacacattttt
gtcattgacggaccgtctcatgatcaagaccagccattttgggaaacgctttcgaaagag
tcgactgagcactcgatcgaagaaacgacggtcgacgatctgctcgcgattcagtataca
tccggctcgaccgggatgccaaaaggcgccatgtggccgcataacgtgctcatcaacatt
tatccgtatatgcgctatgcgattggcctgcgcgatgacgatgtctttttcggcggggcg
gatccgggctgggcgtacgggctgatcttttgcacctttgcaccgatggcctttggcgtg
ccgatcgtcttttacgaagggccgtttaagccggagacgtgctattccttgatggaaaaa
taccgggtgaccaatttcgcgtacgccccgaccgcgtaccgggcgatggcggcggccggc
gcggacgtcattcgccgctatcaactgaacgtgcgcgccatgagctcggccggcgagccg
ctcaatccggaagtcatccgctttttccaagagcacgtgggcgttacgatccatgaccat
tatggcttgtcggaaacgttgatgctgatcggaaacttcaacgccgccgagatggaaatc
cggcccggatcgatgggatggccgctgccgggctttgacgtcgccctgctcaatgagaac
ggaaacccagtcgccgacggcgaagtcggacaaattgcctttaacaccgactcgatcccc
aacgtctttaaggggtattggaaagaccctgaaaaaaccgccgagcggctcgtcggcaag
tggtttttgaccggcgatttggcgacaaaagacgaagacgggtatttctggttccaagga
cgggcggacgacatcatctcgagcgccggctaccgcatcgggccgtttgaaatcgaaagc
tgcctccttgagcatccggctgtcgtcgaagcagccgccgtcgggaagccggatcccgtc
aaaggggaaatcgtcaaagcgtttgtcgtgctcagagaaggctttgcgccgtcggacgag
ctggccgacgagctgtccttgttcgtcaaaacgcgcttatccaagcatgaatacccgcgc
gaagtcgaatttgtcgccgaactgccgaaaacgccgagcggaaaaatccagcggttcatc
ctgcgcaatcaagaaagggaaaagcaaaaaaaagcctaa

DBGET integrated database retrieval system