KEGG   Geobacillus sp. C56-T3: GC56T3_0753Help
Entry
GC56T3_0753       CDS       T01245                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GC56T3_0753
   01230 Biosynthesis of amino acids
    GC56T3_0753
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GC56T3_0753
   00030 Pentose phosphate pathway
    GC56T3_0753
   00051 Fructose and mannose metabolism
    GC56T3_0753
   00052 Galactose metabolism
    GC56T3_0753
  Energy metabolism
   00680 Methane metabolism
    GC56T3_0753
Enzymes [BR:gct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GC56T3_0753
Protein phosphatases and associated proteins [BR:gct01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GC56T3_0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
805054..806013
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDIIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQIVDHDIAEAL
AKTHTVDQRMYTLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtgtgttgacaagcggcggcgactcgccgggcatgaatgcggccatt
cgcgctgtcgtccgcaaagcgatttaccatggggtggaagtgtacggaatctaccacggg
tatgccgggttgatcgccggcaatatcaaaaagctggaagtcggggacgtcggggacatc
atccatcgcggcggcaccatcctttataccgcgcgctgcccggagtttaagacggaagaa
ggacagaaaaaggggatcgagcagctgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacgggtcgtatcaaggggcgaaaaaattgacggagcacggcttcccgtgcgtc
ggcgtgcccgggacgatcgacaacgacattccaggcaccgatttcacgatcggttttgac
accgcgctcaatacggtcattgacgccattgacaaaatccgcgacacggcgacgtcgcat
gagcggacgtacgtcgtcgaagtgatgggccgccatgccggcgatattgcgctatggtcg
gggcttgccggaggggcggagacgattttgattccggaagcggactacgacatggacgac
atcatcgctcgcttgaagcgcggccatgaacgcggcaaaaaacacagcatcatcatcgtc
gccgagggagtcggcagcggcgtcgacttcggccggcaaattcaagaggcgaccggcttt
gagacgcgcgtgacggtgcttggccacgtgcagcgcggcggatcgccgacggcgtttgac
cgcgtgttagcgagccgcctcggcgcccgtgcggtcgagctgctccttgaaggcaaaggc
ggccgctgcgttggcattcaaaacaaccaaatcgttgaccatgacattgccgaagcgttg
gcgaaaacacatacggtcgatcagcggatgtatacattgtcgaaagagctgtcgatttaa

DBGET integrated database retrieval system