KEGG   Geobacillus sp. C56-T3: GC56T3_0779Help
Entry
GC56T3_0779       CDS       T01245                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
gct  Geobacillus sp. C56-T3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
832405..833493
Genome map
AA seq 362 aa AA seqDB search
MAKLDETLTMLKALTDAKGVPGNEREARDVMKTYIAPYADEVTTDGLGSLIAKKEGKSGG
PKVMIAGHLDEVGFMVTQIDDKGFIRFQTLGGWWSQVMLAQRVTIVTKKGDITGVIGSKP
PHILPPEARKKPVEIKDMFIDIGATSREEAMEWGVRPGDMIVPYFEFTVLNNEKMLLAKA
WDNRIGCAVAIDVLKQLKGVDHPNTVYGVGTVQEEVGLRGARTAAQFIQPDIAFAVDVGI
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLREFVIEVAEELNIPHHFDAMPGGGT
DAGAIHLTGIGVPSLTIAIPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDADKVKQLTF
DE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagttggacgaaacgttgacgatgctgaaagcgctgaccgatgcgaaaggcgtc
ccgggcaatgagcgggaagcgcgcgacgtgatgaagacatacatagctccgtatgcggat
gaagtgacaacggatggcctcggcagcttgatcgccaaaaaagaagggaaatcgggcggg
ccgaaagtgatgatcgccggccatttggatgaagtcggctttatggtgacgcaaatcgac
gacaaaggattcatccgcttccaaacgcttggcggatggtggagccaagtaatgctcgcc
cagcgcgtgacgatcgtgacgaaaaaaggcgacatcaccggcgtcatcggttcgaagccg
ccgcacattctgccgccggaggcgcgcaaaaaaccggtggaaatcaaagatatgttcatc
gacatcggcgcgacaagccgcgaggaagcgatggagtggggcgtccgcccgggcgatatg
atcgtgccgtattttgaatttacggtattgaacaatgaaaaaatgctgctcgcgaaagca
tgggacaaccggatcggctgtgcggtcgccatcgatgtgctcaagcagctgaaaggcgtc
gaccatccaaacacggtatacggcgtcggcacggtgcaggaagaagtcggcttgcgcggc
gcgcgcacggccgcccaattcattcagccagatatcgcgtttgctgttgatgtcggcatt
gccggcgatacgccgggcgtgtcggaaaaagaagcgatgggcaaactcggcgccggcccg
cacatcgtcttgtacgacgcaacgatggtgtcgcaccgcggcttgcgcgaatttgtcatc
gaagtggcggaagagctgaacattccgcaccattttgacgccatgccaggcggcggtacg
gacgcgggagcgattcacttaaccggcatcggcgttccgtcgctcacgattgccatcccg
acgcgctacatccactcgcacgccgccattttgcaccgcgacgactacgaaaacacggtc
aagctgcttgttgaggtgatcaaacggcttgacgccgacaaagtgaaacaactgacgttt
gacgaataa

DBGET integrated database retrieval system