KEGG   Geobacillus sp. C56-T3: GC56T3_0805Help
Entry
GC56T3_0805       CDS       T01245                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gct01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:gct00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
860095..860868
Genome map
AA seq 257 aa AA seqDB search
MDFFRLAKEEFVAVVTFSRPPANALSSAVLKEFSTVLDELETDPEVRVVLLHGEGRFFSA
GADIKEFTSIASAEEASGLSRNGQLVMERIERFSKPVIAAIHGAALGGGLELAMSCHIRV
VAENAKLGLPELQLGIIPGFAGTQRLVRYVGFGKAAEMMWTSEPITGLEAVEWGLANKAV
PEERLLDEAKALAKKIAAKSPLSVRATIEVLNAAKEKSFAEAVREEAEWFGRVFVSEDAK
EGVQAFLEKRPPVFKGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggacttttttcgtttggcgaaagaggagttcgtcgccgtcgtgacgttttcgcggccg
ccggcgaacgccctttcatcagcggttttgaaagagttttcaaccgtgttggacgagctc
gagaccgacccggaagtacgcgtcgtgctgcttcatggcgaaggaagatttttctcagcc
ggcgccgatattaaagaattcacgtccatcgcttccgctgaggaggcatccggcttgtcg
cgcaacggccaactcgtgatggagcggatcgaacgcttttccaaaccagtcattgcggcg
attcacggcgccgcattaggcggtgggttggagctggctatgagctgccacattcgcgtg
gtggcggaaaacgccaaactcggccttccggagctgcagcttggcatcatccctggattt
gctggcacgcagcggcttgtgcgctacgtcggctttggcaaagcggcggaaatgatgtgg
acgagcgagccgatcaccggactcgaagcggttgaatgggggcttgccaacaaggcggtg
ccggaagagcggcttcttgatgaagcaaaagcgttggcgaaaaagattgccgccaaaagt
ccgctttccgtccgtgcgacgattgaagtgctcaacgccgcgaaggaaaaatcgtttgcc
gaggcagtgcgcgaggaagcggaatggtttggccgcgtgtttgtatccgaggatgcaaaa
gaaggcgtgcaggcgtttttggaaaaacggccgcctgtctttaaagggaaatga

DBGET integrated database retrieval system