KEGG   Geobacillus sp. C56-T3: GC56T3_0847Help
Entry
GC56T3_0847       CDS       T01245                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GC56T3_0847
Enzymes [BR:gct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GC56T3_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
905400..906167
Genome map
AA seq 255 aa AA seqDB search
MTHSALAGKTVLVTRGKEQAASFSAKLRAVGAVPVEIPLIAIRPAAPEEIASMVERLGEY
RWLVFTSANAVRFFFPHVSLPRPLPEMAVVGRKTAAALAEHGLSPALVPDDYTAERLADL
LMPRVKQGDRVLFVKGNLARPTLPEALRNAGAAVDELTVYETEPDESGRERLLSLLRRRE
LDAVTLMSPSTVDSLVRLLDKEADVLLSGVAVACIGPVTKEAAERAGIPVHICPTDYTTD
GIIKAMEQYFSMEGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacacacagcgcgctcgccggcaaaacggtgctcgtgacgcgcggcaaagagcaggcc
gcgtcattttctgccaagctgcgcgctgtcggcgccgtgccggtcgagatcccgctcatt
gccattcgaccggcggcgccggaagaaatcgcttctatggttgagcggcttggcgaatac
cgttggctcgttttcacaagcgcgaacgccgtccgcttcttttttccacatgtttcgttg
ccgcgtccgctgccggagatggctgtcgtcggccggaaaacagcggcggcgctcgccgag
catggtctttccccggcgctcgtgccggatgattacacggctgaacggctggctgacttg
ctcatgccgcgcgtcaaacaaggcgaccgggtgctgtttgtcaaaggcaatttggcgcgc
ccgaccttgcctgaggcgttgcgaaacgccggcgccgcggtcgacgagctcacggtgtat
gagaccgagcctgatgaaagcggccgggagcggttgttgtcgctgctgcgccggcgggag
cttgatgcggtcaccttgatgagcccgtcgacggttgacagccttgtccgccttctcgac
aaagaagcggatgtccttctttccggtgttgcggtcgcctgcatcggaccggtgacgaaa
gaagcggccgagcgggcgggcattccggtccatatttgtccgacggattacaccacggat
ggtataatcaaagcgatggaacaatatttttccatggagggacgatga

DBGET integrated database retrieval system