KEGG   Geobacillus sp. C56-T3: GC56T3_1045Help
Entry
GC56T3_1045       CDS       T01245                                 

Definition
glucokinase, ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GC56T3_1045
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GC56T3_1045
   00052 Galactose metabolism
    GC56T3_1045
   00500 Starch and sucrose metabolism
    GC56T3_1045
   00520 Amino sugar and nucleotide sugar metabolism
    GC56T3_1045
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GC56T3_1045
   00524 Butirosin and neomycin biosynthesis
    GC56T3_1045
Enzymes [BR:gct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GC56T3_1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1100484..1101437
Genome map
AA seq 317 aa AA seqDB search
MEPWLVGIDLGGTTIKMAFVTTEGDIVHKWEIPTNTANRGEHIVADIARSLEKTLAQLGG
AKERLLAAGIGAPGPVEEETGMLYETVNIGWTNYPLKQRLEEATGLPVSVDNDANLAALG
EMWKGAGGGARHLLFVTLGTGVGGGVIANGAIVRGINGAGGEIGHMTMIPDGGSRCNCGK
TGCLETIASATGIVRIAKEKLTADERPSELRNGDVTAKAVFDAAKAGDALALEVVDEATY
YLGWALANAANVTNPEKIVIGGGVSKAGDMLVERVAAHFRRFAFPRVAAGAKLVLATLGN
DAGVIGAAWLAKELVGA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatggttggtaggcattgacctcgggggcacgacaatcaaaatggcgtttgtc
accaccgagggtgacatcgtgcacaaatgggaaattccgacgaacaccgccaatcgcggt
gagcatatcgtcgctgacattgcccgatcgcttgaaaagacgctcgcccagctcggcgga
gcgaaagagaggctgcttgccgccggcatcggcgcccccggaccggtcgaagaggaaacc
ggcatgttgtatgagacggtcaatatagggtggacgaattatccattgaagcaacggctg
gaagaggcgacggggctgcccgtttcggtcgataatgacgccaatctcgccgcgcttggc
gaaatgtggaaaggagcagggggaggagcgcgccatttgttgtttgtgacgcttggcacc
ggcgttggcggcggtgtgattgccaacggagccattgtgcgcggcataaacggcgccggc
ggagagatcggacatatgacgatgatccctgatggcggctcccgttgcaactgcggcaaa
accggatgtttggaaacgattgcgtccgccaccggcatcgtgcggatcgccaaggagaaa
ttgaccgcagatgagcgtccgagtgagcttcgcaacggggatgtgacggccaaagcggtg
tttgacgccgccaaagcgggcgatgcgctggcattggaagtggtcgatgaagcaacgtac
tatcttggttgggcgttggcgaatgccgccaatgtgacgaacccggagaaaatcgtgatc
ggcggcggcgtgtccaaggcgggtgacatgcttgtcgagcgcgtggccgcccatttccgc
cgcttcgcgttcccgcgcgtcgccgctggggcgaagcttgttttagcgacgcttggcaac
gatgccggcgtcatcggcgccgcctggctggcgaaagagcttgtcggcgcgtaa

DBGET integrated database retrieval system