KEGG   Geobacillus sp. C56-T3: GC56T3_1166Help
Entry
GC56T3_1166       CDS       T01245                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GC56T3_1166
Enzymes [BR:gct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     GC56T3_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1231718..1233085
Genome map
AA seq 455 aa AA seqDB search
MSQQRKSIIPDNFLWGGAVTSFQTEGAWNEGGKGLSIVDARPIPKGHSDWKVAVDFYHRY
KEDIALFKELGFTAYRTSIAWTRIFPDGEGEPNEAGLAFYDAVFDELRANGIEPVITLYH
FDLPLALAKTYNGFASRKVVDLFERYARTIFERYRGKVNYWLTFNEQNLVLEQPHLWGAI
CPEDEDPEAFAYRVCHNVFIAHAKAVKALREIAPEAKIGGMVTYLTTYPATCRPEDALAN
VQAKELFIDFFFDVFARGAYPRYVTNRLEKKGICLPLEAGDEELLRSQTVDFLSFSYYQS
QIVRHQEQDERIIKGLEPNPYLPKTKWGWAIDPIGLRIALKDVYARYEMPIFITENGIGL
EEELNEDGTVEDDERIDYLRRHIEQMKMAMEEGVEVIGYLMWGATDLLSSQGEMRKRYGV
IFVNRDDENLRDLKRYKKKSFYWFQRVIRTNGEEL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacagcgtaaatcgatcatccccgacaactttttatggggcggggcggtgacg
tcgtttcagacggaaggggcgtggaacgaaggcggcaaagggctgtcgatcgttgatgcg
cgcccgattccaaaagggcattccgactggaaagtggcggtcgatttttaccatcgctac
aaagaagacatcgctttgttcaaggagctcggctttaccgcctaccggacgagcatcgct
tggacgcgcatttttccggacggggaaggggagccgaatgaagcgggcttggcgttttat
gacgccgtgtttgatgaattgagagcgaacggcatcgagccggtcattacgctgtaccat
tttgatttgccgctggcgttggcgaaaacgtacaacggctttgcctcgcggaaagtcgtc
gacttgtttgagcggtacgcgcgcaccatatttgagcgttaccgcgggaaagtgaactat
tggctgacgttcaacgaacaaaatttagtgctcgaacaaccgcatttatggggggcgatc
tgcccggaagacgaagacccggaagcgtttgcctaccgcgtctgtcataatgtgttcatc
gcccacgcgaaagccgtgaaggcgctgcgcgaaatcgctcccgaggcgaagatcggcggg
atggtgacgtatttgacgacgtatccggcgacatgccggccggaagacgctttggcgaac
gtgcaggcgaaagagctgttcattgatttcttctttgatgtgttcgcccgcggcgcctat
cctcgttatgtgaccaaccggcttgagaaaaaaggaatctgcctgccgctcgaagcgggg
gatgaggagttgctccgttcgcagacggtcgactttttgtcgttcagctactatcaaagc
caaatcgtccgccatcaggaacaggatgagcggatcatcaaagggcttgaaccgaatccc
tatttgccaaagacgaaatggggctgggcgatcgatccgatcggtttgcggattgcctta
aaagacgtgtacgcccgttacgaaatgccgattttcatcaccgaaaacggcatcgggctt
gaggaggagctgaatgaggacggcacggtcgaagatgatgagcggatcgactatttgcgc
cgccatatcgaacaaatgaagatggccatggaagaaggggtcgaggtgatcggctatttg
atgtggggggcgacggatctattaagctcgcaaggggagatgcgcaagcgctacggcgtc
attttcgtcaaccgcgacgacgagaacttgcgcgatttgaagcgctataagaaaaaaagt
ttttattggttccagcgcgtcattcgcacgaacggggaagagctgtaa

DBGET integrated database retrieval system