KEGG   Geobacillus sp. C56-T3: GC56T3_1288Help
Entry
GC56T3_1288       CDS       T01245                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GC56T3_1288
Enzymes [BR:gct01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     GC56T3_1288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1340935..1341501
Genome map
AA seq 188 aa AA seqDB search
MPEINFAQIEYAVRLILEAIGEDPNREGLVDTPKRVAKMYAEVFAGLQEDPKQHFQTVFS
EEHEELVLVKDIPFYSMCEHHLVPFFGAAHVAYIPREGKVTGLSKLARAVEAVARRPQLQ
ERITATIADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVFETDANARA
EVLSLIKA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgccagagatcaattttgcgcaaattgaatatgcggtccgcctcattcttgaggcgatc
ggggaagatccaaaccgcgaagggctcgtcgatacgccgaagagggtggcgaaaatgtac
gccgaggtgttcgctgggctgcaggaagacccgaagcagcactttcaaaccgtattcagc
gaggaacatgaggagcttgtgctcgtcaaagatattccgttttattcgatgtgcgaacac
catttagtgccgttttttggcgctgcccacgtcgcctatattccgcgggaagggaaagtg
accgggctgagcaagctcgctcgagccgttgaggcggtggcgcgccgcccgcagctgcaa
gagcgcatcacggcaacgatcgctgattcgatcgtcgaggcgcttgagccgcatggggtg
atggtcgtcgttgaggcggagcatatgtgcatgacgatgcgcggggtgaaaaaaccgggg
gccaaaacagtgacaacagcggtgcgcggcgtgtttgaaacagatgccaacgcccgcgct
gaagtgctttcgttaatcaaagcgtaa

DBGET integrated database retrieval system