KEGG   Geobacillus sp. C56-T3: GC56T3_1300Help
Entry
GC56T3_1300       CDS       T01245                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GC56T3_1300
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GC56T3_1300
Enzymes [BR:gct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GC56T3_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1351223..1352002
Genome map
AA seq 259 aa AA seqDB search
MMLEQILAAKREEVETLTLPAPLPERKRRPFAAALRRPRRMLGLIAEVKKASPSKGIIRP
NFDPVAIAKAYERAGADAISVLTDERYFQGHRRYLRAVKEAVNVPVLRKDFIIDRRQVEE
SVRLGADAILLIGEALPPETLEELYHEAYSLGLECLVEVHAKETLERIFDRFTPEIVGIN
NRDLHTFVTTLEATKTLAPLIPPSCVIVSESGIGSFNDVKTVKSYGAQAMLVGESLMRQD
DVERAVYRLFGEEGGDDSN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttgagcaaattttagcagccaaacgggaagaagtggaaacgttgacgctgccg
gcgccattgccagagcgaaagcgccggccatttgcggcggcgctccgtcggccgcggcgg
atgcttggcttgatcgctgaggtgaaaaaagcgtcgccgtcaaaaggcatcattcgcccg
aattttgacccggtggccatcgcgaaagcatatgagcgcgccggtgccgacgcgatcagc
gtgctgacggatgaacggtatttccaagggcatcgccgctatttgcgagcggtgaaagaa
gcggttaacgttcccgtgctgcgcaaagatttcatcatcgatcggcggcaagtcgaggaa
agcgtccgactcggggcggatgcgattttattgatcggcgaggctctcccgccggaaaca
ctcgaggagctctatcatgaagcgtacagcttggggctcgaatgtctggtcgaggtgcat
gcaaaagagacgctcgagcggattttcgatcggtttacgccggagatcgtcggcatcaac
aaccgcgacttgcatacctttgtgacaacacttgaggcgaccaaaacgctcgctccgctc
atcccgccatcgtgcgtcatcgtcagcgaaagcgggatcggttccttcaatgatgtgaag
acggtcaaatcgtacggagcgcaggccatgctcgtcggcgagtcgctcatgcgccaagat
gatgtggagcgagcggtctaccggctgtttggggaggaaggtggggatgattcgaattaa

DBGET integrated database retrieval system