KEGG   Geobacillus sp. C56-T3: GC56T3_1303Help
Entry
GC56T3_1303       CDS       T01245                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00260  Glycine, serine and threonine metabolism
gct00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01130  Biosynthesis of antibiotics
gct01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GC56T3_1303
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GC56T3_1303
Enzymes [BR:gct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GC56T3_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA ThiG PcrB
Motif
Other DBs
NCBI-ProteinID: ADI26329
JGI: GC56T3_1303
Position
1354186..1355001
Genome map
AA seq 271 aa AA seqDB search
MKTLPLSVNPPLFIPFIVAGDPAPDVTIDLASALEEAGADILELGVPYSDPLADGPTIQR
AAARALDGGMTLPKAIQLIGEMRKKGVNIPIILFTYYNPVLQLGEESFFALARENGADGV
LIPDLPFEESGPLRELGERFGLPLISLVAPTSKQRIERIASAAQGFLYCVSSLGVTGVRE
TLPETLGDFLREVKRHSRVPVAVGFGISAPEQVAMLKEVCDGVVVGSALVQKVEQLAPRL
QAPDEREAAVAEFSAYARSLAAPLREAYSSR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacattgccactgtccgttaatccgccgctatttatcccgtttatcgttgccggt
gatccggctcccgatgtgacgatcgatctcgcctcggcgcttgaggaggccggcgctgac
atattagagcttggcgtgccgtactccgacccgctcgctgacggaccgacgattcaacgc
gccgccgcaagggcgcttgacgggggcatgacgctgccgaaagccattcagcttattggc
gagatgcgaaaaaaaggggtaaacattccgattattctctttacgtattacaatcctgtg
ttacaattaggagaagaatccttttttgctttagcgcgggaaaatggcgccgacggcgtg
ctcattcccgatttgccgtttgaggaaagcggtccgctccgcgaacttggcgaacggttt
ggtctcccgctcatttcgcttgttgcgccgacgtcgaagcagcggatcgagcggatcgct
tcggcggcgcaagggtttttgtattgcgtctcctcgctaggtgttacaggcgtgcgtgag
acgctgccggagacgctcggcgatttcctccgcgaagtgaagcggcatagccgcgtcccg
gtcgccgtcggctttggcatttcggcgccggagcaagtcgcgatgttgaaagaggtgtgc
gacggcgttgtcgtcggcagcgcgctcgtgcaaaaagtcgagcagctggctccgaggttg
caggcgccggacgaaagggaagcggccgtcgccgagttttctgcctacgcccgttcgctt
gccgcgccgcttcgagaagcctattcttcgcgctaa

DBGET integrated database retrieval system