KEGG   Geobacillus sp. C56-T3: GC56T3_1481Help
Entry
GC56T3_1481       CDS       T01245                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gct01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gct00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1558416..1559540)
Genome map
AA seq 374 aa AA seqDB search
MKRQRVVIKIGSSSLTDPKGGLCHDKLFDHVEAIAYLKQLGHDVILITSGAVAAGFGPLG
YPARPTTIAGKQAAAAVGQSLLMQAYSSAFAQFGFTAAQLLLTRSDFYSRERFRNLFATI
TTLLENGAVPIINENDSVSIEELTFGDNDMLSALVAGFLHADALILLTDINGLYDANPKT
NPQAKKYAFLPEITDEMIEAAGGIGSAVGTGGMRSKLLAARKALSFGVSVFIGAGSGKEK
LADILAGKGDGTYIGAPFPKQMQMRKQWIAYHAPVAGTVTVDSGAEEALLMRGKSLLPAG
VTAVSGDFHAMDVVDVVNEKGITIGRGQVYYAAADLEKVKGLPSEEARQYSYLHRPEVIH
RDNWVTLRKESVSK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggcagcgcgtggtgatcaaaatcggcagcagttcgctcaccgatccgaaaggc
ggcctttgccatgacaagctgttcgatcacgttgaggcgatcgcttatctcaaacagctc
ggccatgacgtcattctcatcacgtccggcgctgtcgccgctggtttcggacctttaggc
tacccggcgcgcccgacgacaatcgccgggaaacaggcggccgcggccgtcgggcaaagt
ttgctcatgcaggcgtacagctcggcgttcgcccaattcggctttacggccgctcagctg
ttgttgacgcgcagcgacttttacagccgcgagcggttccgcaacttgtttgccacgatc
accacactgcttgagaacggcgccgtgccgatcattaatgaaaacgactccgtttccatc
gaggaattgacatttggcgacaatgacatgctttcggcgcttgtcgccggctttttgcac
gctgatgcgctcattttgcttacggacattaacgggttgtatgacgccaatccgaaaacg
aatccgcaggcgaaaaaatacgcctttttgccggaaatcaccgatgagatgatcgaagcc
gccggcggcatcggttcagccgtcggcaccggcgggatgcgctcgaagcttctcgcggct
cgaaaagcactctcgtttggcgtcagcgtgttcatcggcgcagggagcggcaaagaaaaa
ctggctgatattttagctggaaaaggagacggcacgtacatcggcgctccgtttccgaaa
caaatgcaaatgcgcaaacaatggattgcttatcatgctcctgtcgccggcacggtcacg
gtcgacagcggggctgaggaagcgttgcttatgcgtgggaaaagtttgctccccgctggc
gtaacagctgtttccggcgattttcacgccatggatgtcgtggatgtcgtcaatgaaaaa
gggatcacgatcggacgcggccaagtgtattatgccgccgccgatttagagaaagtgaaa
ggacttccaagcgaggaagctcggcaatattcctaccttcaccgcccggaagtcatccac
cgcgacaattgggtcacgttgcgaaaggagagtgtatcgaaatga

DBGET integrated database retrieval system