KEGG   Geobacillus sp. C56-T3: GC56T3_1530Help
Entry
GC56T3_1530       CDS       T01245                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:gct00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:gct00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1609964..1610737
Genome map
AA seq 257 aa AA seqDB search
MEHRTALITGAARGIGYEVAKTLAEHGANVVLIDLRQEEVEQAARSLRELGYEAVGVKCD
VTVEQEVKQAINEAVSRWGRLDVVVNNAGLQHVANIEDFPTEKFEQLIRVMLVGPFLAIK
HAFPIMKQQRYGRIINMASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGAPHGITVNAL
CPGYVDTELVRGQLADLAATRNVPLEKVLEEVIYPFVPQRRLLSVEEVAHYVLFLAGEQA
KGITGQAVVIDGGYTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcgcacagcactcatcaccggcgcagcgcggggaatcggctatgaagtggcg
aaaacgctggcggaacatggcgcaaacgtggtgctcattgatttgcgccaggaagaggtc
gagcaggctgctcgatcgcttcgggagttgggctatgaagcggtcggcgtgaaatgtgat
gtgacggttgaacaagaggtgaagcaagcgatcaacgaagcggtcagccgttgggggcgc
ctggatgttgtcgtgaacaacgctggtttgcaacatgtggcgaacatcgaggatttcccg
acggaaaaatttgaacagctcattcgcgtcatgcttgtcggcccatttttggccatcaag
catgcgtttcccattatgaaacaacagcgctacggccgcatcatcaatatggcgtcgatc
aacgggctcgtcgggtttgccggcaaagcggcgtacaacagcgcgaagcacggggtgatt
ggcttaacgaaagtggcagcgttagaaggggcgccacacggcattacggtgaacgccctt
tgcccgggttatgtcgataccgagctcgtgcgcggccagctcgcggatttggcggcgaca
agaaacgtgccgcttgagaaagtgctggaggaagtgatttacccgttcgtgccgcagcgg
cggctgctatcggttgaagaggtggctcattacgttctctttttggcgggggaacaagcc
aaaggcatcactggccaggcggtcgtgatcgatggcgggtatacggcgcaatga

DBGET integrated database retrieval system