KEGG   Geobacillus sp. C56-T3: GC56T3_1642Help
Entry
GC56T3_1642       CDS       T01245                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
gct  Geobacillus sp. C56-T3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1736513..1737508
Genome map
AA seq 331 aa AA seqDB search
MNSSLPSLRDVFANDFHIGAAVNPVTIEMQKQLLIDHVNSITAENHMKFEHLQPEEGKFT
FQEADRIVDFACSHRMAVRGHTLVWHNQTPDWVFQDGQGHFVSRDVLLERMKCHISTVVR
RYKGKIYCWDVINEAVADEGDELLRPSKWRQIIGDDFMEQAFLYAYEADPDALLFYNDYN
ECFPEKREKIFALVKSLRDKGIPIHGIGMQAHWSLTHPSLDEIRAAIERYASLGVVLHIT
ELDVSMFEFHDRRTDLAVPTNEMIEQQAERYGQIFALFKEYRDVIQSVTFWGIADDHTWL
DNFPVQGRKNWPLLFDEQHKPKPAFWRAVSV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaacagctccctcccctccctccgcgatgtattcgcgaatgatttccacatcggggcg
gcggtcaatcctgtgacgattgagatgcaaaaacagttgttgatcgatcatgtcaacagt
attacggcagagaaccatatgaagtttgagcatcttcagccggaagaagggaaatttacc
tttcaggaagcggatcggattgttgattttgcttgttcgcaccgaatggcggttcgaggg
cacacacttgtatggcacaaccagactccggattgggtgtttcaagatggtcaaggccat
ttcgtcagtcgggatgtgttgcttgagcggatgaaatgtcacatttcaactgttgtacgg
cgatacaagggaaaaatatattgttgggatgtcatcaacgaagcggtagccgacgaagga
gacgaattgttgaggccgtcgaagtggcgacaaatcatcggggacgattttatggaacaa
gcatttctctacgcttatgaagctgacccagatgcactgcttttttacaatgactataat
gaatgttttccggaaaagagagaaaaaatttttgcacttgtcaaatcgctgcgtgacaaa
ggcattccgattcatggcatcgggatgcaagcgcattggagtttgacccacccatcgttg
gatgaaattcgtgcggccattgaacgatatgcgtcccttggcgttgttcttcatattacg
gaactcgatgtatccatgtttgaatttcacgatcgtcgaaccgatttggctgtcccgacg
aacgaaatgatcgaacagcaagcagagcggtatgggcaaattttcgctttgtttaaggag
tatcgcgatgttattcaaagtgtcacattttggggaattgctgatgaccatacatggctc
gataactttccagtgcaggggagaaaaaactggccgcttttgttcgatgaacagcataaa
ccgaaaccagctttttggcgggcagtgagtgtctga

DBGET integrated database retrieval system