KEGG   Geobacillus sp. C56-T3: GC56T3_1664Help
Entry
GC56T3_1664       CDS       T01245                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GC56T3_1664
   00051 Fructose and mannose metabolism
    GC56T3_1664
Enzymes [BR:gct01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     GC56T3_1664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1766446..1767783
Genome map
AA seq 445 aa AA seqDB search
MAYFPNIGTIPYEGPESRNPLAFKFYNPEEKVGDKTMEEHLRFSVAYWHTFTGDGSDPFG
VGNMIRPWDKYSGMDLAKARVEAAFELFEKLNVPFFCFHDVDIAPEGETLSETYKNLDEI
VDMIEVYMKTSKTKLLWNTANLFSHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGA
ENYVFWGGREGYETLLNTDMKLELDNLARFLHMAVDYAKEIGFDGQFLIEPKPKEPTKHQ
YDFDVATALAFLQTYGLKDHFKFNIEANHATLAGHTFEHELRVARIHGMLGSVDANQGDT
LLGWDTDEFPTDLYATTLAMYEILQNGGLGRGGLNFDAKVRRGSFEPEDLFYAHIAGMDS
FAIGLKVAHRLLEDRVFEQFIEERYKSYTEGIGREIVEGTADFKKLEEYALQLGEIRNAS
GRLERLKTLLNQYLLEVSVPSVSRS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatttcccgaatatcggcaccattccatatgaaggaccggagtcgcgcaatccg
ttggcgtttaagttttataatccggaagaaaaagtcggcgacaaaacaatggaggagcat
ttgcgcttttcggtcgcctattggcatacgttcacgggggatggatcggatccgtttggc
gtcggcaatatgattcgtccgtgggacaaatacagcggcatggatctagcaaaggcgcgc
gtcgaggcggcgtttgagctgtttgaaaagctgaacgttccgtttttctgcttccatgat
gtcgacatcgcgccggaaggggaaacgctcagcgagacgtacaaaaacttggatgaaatc
gtcgatatgattgaagtgtacatgaaaacaagcaaaacgaaactgctgtggaatacggcg
aacttgttcagccatccgcgcttcgttcacggggcagcgacgtcgtgcaacgccgatgtg
ttcgcctatgcggcggcaaaagtgaaaaaaggactcgagatcgccaaacggctcggagcg
gaaaactacgtgttttggggcggccgggaaggttatgagacgctcttgaatacggacatg
aagctggagcttgacaacttagcccgcttcttgcacatggcggtcgactatgcgaaagaa
atcggatttgacggccagtttttgatcgagccgaagccgaaagagccgacgaagcatcaa
tatgacttcgatgtggcgacggcgttggcgttcttgcaaacatacgggctcaaggatcat
ttcaaattcaacattgaagcgaaccatgcgacattggccgggcatacgtttgagcatgag
ctgcgcgtcgcccgcattcatggcatgttgggctcggtcgatgccaaccaaggcgatacg
ctgctcggctgggatacggatgagttcccgacagatttgtatgcgacgacgctggcgatg
tatgaaattttgcaaaacggtggtcttgggcgcggcggcttgaactttgatgcgaaagtg
cggagaggctcgtttgaaccggaggacttgttctacgctcatatcgccgggatggacagc
tttgcgattggtttgaaagtcgctcatcgcttgctggaagaccgcgtgtttgaacagttc
atcgaagaacggtacaaaagctatacagaaggcatcggccgcgagatcgtcgaagggacg
gcggacttcaaaaagcttgaggagtacgccttgcagctcggcgaaattcgcaatgcgtcc
ggccgtctcgaacgcttgaaaacgctgctcaaccaatatttgttggaagtcagcgtgccg
agcgtatcccgttcgtga

DBGET integrated database retrieval system