KEGG   Geobacillus sp. C56-T3: GC56T3_1711Help
Entry
GC56T3_1711       CDS       T01245                                 

Definition
respiratory nitrate reductase subunit gamma (EC:1.7.99.4)
Orthology
K00374  
nitrate reductase gamma subunit [EC:1.7.99.4]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    GC56T3_1711
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GC56T3_1711
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With other, unkown, acceptors
    1.7.99.4  nitrate reductase
     GC56T3_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1816642..1817346)
Genome map
AA seq 234 aa AA seqDB search
MASQFLWVIVPYLALVLFVAGHIWRYQRDQFGWTSKSSELLEKRQLHLGSLLFHWGILFV
FVGHVMGILIPEPFYEALGVTEKMYHALALAGGIPADLAALAGFVILFRRRLTVKRVRVT
SSTGDWVALGFLLVVIASGLSSTLLNVNSHGFDYRTTIGPWFRGLLTFRPDPVYMETVPL
WFKIHILAAFGLFAVWPFTRLVHVFSFPLRYLQRSYVVYRKRMPKQAEPFDRAQ
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccagccaatttctctgggtgattgttccgtatttagcgcttgtcctatttgtcgcc
ggccatatttggcgctaccagcgcgaccagtttggctggacatcaaaatcaagcgaactg
ctcgaaaaacggcagttgcaccttggaagccttctgttccactggggcattttgttcgtg
tttgtcggccacgtgatgggcattctcattcccgagccgttttacgaagcgcttggcgtg
acagaaaagatgtaccacgccctcgccttggcgggcggcattccggccgacttggcggcg
ctcgctggtttcgtgatcctttttcgccgccgcttgacagtcaagcgcgtgcgggtgaca
agcagcaccggcgactgggtcgcgctcggatttttgcttgtcgtgatcgccagcgggttg
tcatcgacattgctgaacgtcaactcacatggctttgactaccgaacgacgatcggtcca
tggttccgcggccttctcacattccgcccggacccggtttatatggaaacggtcccgctt
tggttcaaaatccatattctcgccgcgtttggcttgttcgccgtctggccgtttacccgc
ctcgttcatgtattcagctttccgctccgctacttgcagcgcagctacgtcgtctaccgg
aagcggatgccaaaacaagcggaaccgttcgaccgcgctcagtga

DBGET integrated database retrieval system